CDS Information : ACMV_00150

Display	1000bp 10000bp 100000bp Clone

Acidiphilium multivorum AIU301 (= NBRC 100883) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Acidiphilium multivorum AIU301 (= NBRC 100883)
Replicon	chromosome
Start / Stop / Direction	14,489 / 14,716 / +
Location	14489..14716
Type	CDS
Length	228 bp (75 aa)

Product	Sec-independent protein translocase protein TatA/E
Gene name
Functional category	Transport and Cellular Process - Membrane Transport
EC number
Note
KEGG pathway
Sequence feature
References	HAMAP:MF_00236

BLASTP Database:UniProtKB:2010_04 show BLAST table	1 E=2e-35 A5FUG2_ACICJ Twin-arginine translocation protein, TatA/E family subunit Alignment 2 E=1e-12 C8SF74_9RHIZ Twin-arginine translocation protein, TatA/E family subunit Alignment 3 E=2e-12 TATA_RHILO Sec-independent protein translocase protein tatA/E homolog Alignment 4 E=1e-11 TATA_BRAJA Sec-independent protein translocase protein tatA/E homolog Alignment 5 E=3e-11 TATA_RHOPB Sec-independent protein translocase protein tatA/E homolog Alignment
HAMAP Database:HAMAP:20090211	MF_00236   TATA_MF_00236
InterPro Database:interpro:26.0	IPR003369 Bacterial sec-independent translocation protein mttA/Hcf106 (Family) PF02416   MttA_Hcf106 IPR006312 Twin-arginine translocation protein TatA/E (Family) TIGR01411   tatAE
SignalP	Bacteria, Gram-negative
TMHMM	Transmembrane 1
SOSUI	Transmembrane 1

size of protein	75 amino acids
molecular mass	7,949.26 Da
pI	10.11
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 12 (9aa) 6.7 (5aa) 12 (9aa) 4 (3aa) 2.7 (2aa) 2.7 (2aa) 2.7 (2aa) 5.3 (4aa) 14.7 (11aa) 2.7 (2aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 2.7 (2aa) 0 (0aa) 5.3 (4aa) 6.7 (5aa) 0 (0aa) 8 (6aa) 1.3 (1aa) 2.7 (2aa) 4 (3aa) 4 (3aa)

>ACMV_00150 Sec-independent protein translocase protein TatA/E
ATGGGTGGTTTGAGCATCTGGCACTGGCTGATCGTCCTGGCGGTCGTGCTGCTCCTGTTC
GGAACGGGCCGGGTCGGCAACCTGATGGGTGAGCTCGGCAAGGGCATGAAGGCGTTCAAG
AACAACATCGCCGATGACCAGCCGGCGAAGGATGCCTCGATGCTGGAGCAGCAGACCCGC
GCGCCGGAGGCCAATGCCGGCCAGAAGGCCGGGCAGGGTAAGGTCTGA


>ACMV_00150 Sec-independent protein translocase protein TatA/E
MGGLSIWHWLIVLAVVLLLFGTGRVGNLMGELGKGMKAFKNNIADDQPAKDASMLEQQTR
APEANAGQKAGQGKV

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.