CDS Information : APA32_06940

Display	1000bp 10000bp 100000bp Clone

Acetobacter pasteurianus IFO 3283-32 (= NBRC 105190) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Acetobacter pasteurianus IFO 3283-32 (= NBRC 105190)
Replicon	chromosome
Start / Stop / Direction	717,580 / 717,431 / -
Location	complement(717431..717580)
Type	CDS
Length	150 bp (49 aa)

Product	Hypothetical protein
Gene name
Functional category	Unknown
EC number
Note
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:15.0	No significant hit
HAMAP	No significant hit
InterPro	No significant hit
SignalP	Bacteria, Gram-negative
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	49 amino acids
molecular mass	5,398.14 Da
pI	6.77
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 10.2 (5aa) 2 (1aa) 14.3 (7aa) 0 (0aa) 2 (1aa) 2 (1aa) 2 (1aa) 4.1 (2aa) 8.2 (4aa) 8.2 (4aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 8.2 (4aa) 4.1 (2aa) 0 (0aa) 2 (1aa) 4.1 (2aa) 8.2 (4aa) 6.1 (3aa) 2 (1aa) 8.2 (4aa) 4.1 (2aa)

>APA32_06940 Hypothetical protein
ATGAAACGCGCGGTTCTGCTGCTGGCCTGCACCTTGGGACTATCCGCCTGTGGCATGTTT
AGCTCCAGTGAACCGAAGCATCTGACCACAGCCGCACAGTGGGAAAAATACGGGTATCAC
GATCACCTCAAAACAGGTGATGACGACTAA


>APA32_06940 Hypothetical protein
MKRAVLLLACTLGLSACGMFSSSEPKHLTTAAQWEKYGYHDHLKTGDDD

NBRC No.	clone name	start	stop	length(bp)
G15-001-035	AS1FE12L00021F04	699,849	736,265	36,417

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.