CDS Information : BBR47_01720

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	182,427 / 183,011 / +
Location	182427..183011
Type	CDS
Length	585 bp (194 aa)

Product	para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II
Gene name	pabA Synonym: trpG
Functional category	Intermediary metabolism - Metabolism of coenzymes and prosthetic groups
EC number	4.1.3.27 2.6.1.85
Note	2 BBR47_01720 products and 2 BBR47_24730 products may form a tetramer.
KEGG pathway
Sequence feature
References	Uniprot:P28819 Pubmed:2123867

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=2e-80 A8W1V8_9BACI Anthranilate/para-aminobenzoate synthase component II-like protein Alignment 2 E=2e-79 B0AWK5_BACAN Para-aminobenzoate synthase, glutamine amidotransferase component Alignment 3 E=2e-79 A0R8E2_BACAH Aminodeoxychorismate synthase, glutamine amidotransferase subunit Alignment 4 E=2e-79 Q6HPU7_BACHK Anthranilate synthase, component II Para-aminobenzoate synthase glutamine amidotransferase, component II Alignment 5 E=2e-79 Q81VX0_BACAN Para-aminobenzoate synthase glutamine amidotransferase, component II Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR000991 Glutamine amidotransferase class-I (Domain) PF00117   GATase IPR001317 Carbamoyl-phosphate synthase, GATase region (Domain) PR00099   CPSGATASE IPR006220 Anthranilate synthase component II/delta crystallin (Domain) PR00097   ANTSNTHASEII IPR006221 Glutamine amidotransferase of anthranilate synthase (Domain) TIGR00566   trpG_papA: glutamine amidotransferase of an IPR006221 Anthranilate synthase/para-aminobenzoate synthase, glutamine amidotransferase (Family) TIGR00566   trpG_papA: glutamine amidotransferase of an IPR011702 Glutamine amidotransferase superfamily (Domain) PR00096   GATASE IPR012998 Glutamine amidotransferase, class I, active site (Active_site) PS00442   GATASE_TYPE_I
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	194 amino acids
molecular mass	21,761.86 Da
pI	5.52
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 6.7 (13aa) 5.7 (11aa) 7.2 (14aa) 9.8 (19aa) 4.1 (8aa) 0 (0aa) 5.2 (10aa) 3.6 (7aa) 8.2 (16aa) 5.2 (10aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 6.2 (12aa) 1 (2aa) 2.6 (5aa) 3.6 (7aa) 4.1 (8aa) 3.6 (7aa) 4.6 (9aa) 5.2 (10aa) 3.6 (7aa) 9.8 (19aa)

>BBR47_01720 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II
ATGATTTTGATGATTGATAACTACGATTCCTTTACCTACAATTTGGTGCAGTATGTGGGA
GAGCTTGGGGAAGAGCTCCAAGTGTATCGCAATGACAAGATTACGCTGGAAGAAATCGAG
CGACTGGCACCTGATTATTTGATGGTGTCTCCAGGACCGTGCACGCCAAATGAAGCGGGG
ATCAGCATGGATGCGATCCGCCATTTTGCCGGAAAAATTCCGATCATGGGTGTTTGCTTG
GGCCATCAGTCCATTGGGCAAGTGTTTGGCGGAAAAGTCATTCGGGCCGAGCGCTTGATG
CACGGAAAGACGTCGGAAGTTTTCCATGATGGCAAAACTATCTTTCAGGACATCCCGTCC
CCTTTTACAGCGGCACGCTACCATTCCTTGATTATCGAGGAAGCGTCGATTCCGAGTGAG
CTGGAAGTAACCGCTCGGACAGCCGAAGGTGAAATTATGGCTGTGCGCCATCGGGAGTAC
CCAATCGAGGGCGTCCAGTTCCACCCTGAATCGATTATTACCGAGCACGGCAAGCAATTG
CTGAAGAACTTCCTTACTGCATACGCGCGCCATACGACAGGTTAA


>BBR47_01720 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II
MILMIDNYDSFTYNLVQYVGELGEELQVYRNDKITLEEIERLAPDYLMVSPGPCTPNEAG
ISMDAIRHFAGKIPIMGVCLGHQSIGQVFGGKVIRAERLMHGKTSEVFHDGKTIFQDIPS
PFTAARYHSLIIEEASIPSELEVTARTAEGEIMAVRHREYPIEGVQFHPESIITEHGKQL
LKNFLTAYARHTTG

NBRC No.	clone name	start	stop	length(bp)
G10-001-007	BB1FE1L10021A04	168,769	206,029	37,261
G10-001-008	BB1FE1L10026G12	174,415	210,036	35,622

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.