CDS Information : BBR47_02730

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	276,621 / 276,719 / +
Location	276621..276719
Type	CDS
Length	99 bp (32 aa)

Product	hypothetical protein
Gene name
Functional category	Similar to unknown proteins - Partially similar to unknown proteins
EC number
Note
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=5e-05 Q4V1G7_BACCZ Transposase Alignment 2 E=5e-05 A8MFT0_ALKOO Integrase catalytic region Alignment 3 E=0.0001 A8MLZ0_ALKOO Integrase catalytic region Alignment 4 E=0.0001 A8U986_9LACT Transposase Alignment 5 E=0.0004 Q892Z8_CLOTE Putative transposase Alignment
HAMAP	No significant hit
InterPro	No significant hit
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	32 amino acids
molecular mass	3,752.30 Da
pI	9.81
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 9.4 (3aa) 6.3 (2aa) 3.1 (1aa) 3.1 (1aa) 9.4 (3aa) 0 (0aa) 6.3 (2aa) 3.1 (1aa) 3.1 (1aa) 3.1 (1aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 9.4 (3aa) 0 (0aa) 6.3 (2aa) 0 (0aa) 6.3 (2aa) 12.5 (4aa) 0 (0aa) 6.3 (2aa) 3.1 (1aa) 9.4 (3aa)

>BBR47_02730 hypothetical protein
ATGAAAGGCTACCCTTACGACAATGCAGTCGCAGAAGCGACTTTTAAGCTGATCAAAACG
GAGTTTGTAAAGAATCGAAGGTTTGAGTCACCAACATAG


>BBR47_02730 hypothetical protein
MKGYPYDNAVAEATFKLIKTEFVKNRRFESPT

NBRC No.	clone name	start	stop	length(bp)
G10-001-009	BB1FE1L10029E04	265,703	304,114	38,412

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.