CDS Information : BBR47_02790

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	280,055 / 280,270 / +
Location	280055..280270
Type	CDS
Length	216 bp (71 aa)

Product	hypothetical protein
Gene name
Functional category	Similar to unknown proteins - Partially similar to unknown proteins
EC number
Note
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=3e-06 Q209P2_AERHY Transcriptional repressor protein KorA Alignment 2 E=3e-06 Q68E88_AERPU TrfB transcriptional repressor protein Alignment 3 E=0.0003 Q5W3F4_9ZZZZ Transcriptional repressor KorA Alignment 4 E=0.0008 Q76LZ2_COMAC KorA Alignment 5 E=0.0008 Q4LCB7_9ZZZZ KorA protein Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR013324 RNA polymerase sigma factor, regions 3 and 4 (Domain) SSF88659   Sigma3 and sigma4 domains of RNA polymerase sigma factors
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	71 amino acids
molecular mass	8,006.15 Da
pI	7.86
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 7 (5aa) 8.5 (6aa) 8.5 (6aa) 7 (5aa) 0 (0aa) 2.8 (2aa) 2.8 (2aa) 2.8 (2aa) 7 (5aa) 5.6 (4aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 8.5 (6aa) 0 (0aa) 1.4 (1aa) 5.6 (4aa) 1.4 (1aa) 7 (5aa) 5.6 (4aa) 5.6 (4aa) 4.2 (3aa) 8.5 (6aa)

>BBR47_02790 hypothetical protein
TTGAAGCGCCTGAAAGAACGAAATATTCAGGTGATTTACGAACACCTGGTCGACGGTCGA
CAACAAACTGAACTTGCCGACGAACTAGGCATCACGAAGAAGGCGGTAAGCCAGATGGTC
AGCAAGGTATGGGCGCTGCACATCGAGCACGGCGAACGGCCGGACGGTTGGACAAGTATT
AGCGTCACTCTGGGCGCTGCGCACACTACGCCTTAG


>BBR47_02790 hypothetical protein
MKRLKERNIQVIYEHLVDGRQQTELADELGITKKAVSQMVSKVWALHIEHGERPDGWTSI
SVTLGAAHTTP

NBRC No.	clone name	start	stop	length(bp)
G10-001-009	BB1FE1L10029E04	265,703	304,114	38,412

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.