CDS Information : BBR47_02950

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	295,385 / 295,693 / +
Location	295385..295693
Type	CDS
Length	309 bp (102 aa)

Product	probable transcriptional regulator
Gene name
Functional category	Information pathways - RNA synthesis - - Regulation
EC number
Note	ArsR family.
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=7e-42 Q5WI86_BACSK ArsR family transcriptional regulator Alignment 2 E=3e-38 Q65P41_BACLD Putative uncharacterized protein Alignment 3 E=1e-37 A2U8K7_BACCO Transcriptional regulator, ArsR family Alignment 4 E=1e-36 A7Z5E2_BACA2 Putative uncharacterized protein Alignment 5 E=6e-22 Q02S02_PSEAB Putative transcriptional regulator Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR001845 Bacterial regulatory protein, ArsR (Domain) PF01022   HTH_5 PS50987   HTH_ARSR_2 SM00418   no description IPR001845 Bacterial regulatory protein, ArsR (Family) SM00418   no description PS50987   HTH_ARSR_2 PF01022   HTH_5 IPR011991 Winged helix repressor DNA-binding (Domain) G3DSA:1.10.10.10   no description
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	102 amino acids
molecular mass	11,934.79 Da
pI	8.47
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 3.9 (4aa) 2.9 (3aa) 7.8 (8aa) 11.8 (12aa) 3.9 (4aa) 1 (1aa) 2.9 (3aa) 3.9 (4aa) 4.9 (5aa) 7.8 (8aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 6.9 (7aa) 1 (1aa) 2 (2aa) 5.9 (6aa) 3.9 (4aa) 6.9 (7aa) 2.9 (3aa) 6.9 (7aa) 2.9 (3aa) 9.8 (10aa)

>BBR47_02950 probable transcriptional regulator
ATGCGTATGGATCCAATTGAAATTTTTAAAGCGCTGTCCAACGAGTCTAGACTCCAAATT
CTACATTGGTTAAAAGAGCCTGAAAAACATTTTATACCCCATGAAGGAGTGGATATGAGA
ACGATCGGGGTATGCGTCAGTCAAATAACTGAGAAATTGAATATGACTCAGTCAACTGCG
TCCCAATATTTGTCCATTCTCCAACGCGCTGGGCTAATCAAGACGGAGCGTATTGGGAAA
TATACGTACTATACCAGGGACGAGGAAAAAATACGTGAAATAGGCGCTTTTTTTAGCAGT
CAAATATGA


>BBR47_02950 probable transcriptional regulator
MRMDPIEIFKALSNESRLQILHWLKEPEKHFIPHEGVDMRTIGVCVSQITEKLNMTQSTA
SQYLSILQRAGLIKTERIGKYTYYTRDEEKIREIGAFFSSQI

NBRC No.	clone name	start	stop	length(bp)
G10-001-009	BB1FE1L10029E04	265,703	304,114	38,412
G10-001-010	BB1FE1L10033D08	292,603	334,912	42,310

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.