CDS Information : BBR47_05670

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	590,130 / 590,585 / +
Location	590130..590585
Type	CDS
Length	456 bp (151 aa)

Product	hypothetical membrane protein
Gene name
Functional category	Similar to unknown proteins - Partially similar to unknown proteins
EC number
Note	Containing a peptidase A24A, prepilin type IV domain (IPR000045). BBR47_05670 to BBR47_05720; The order of these six ORFs is partially conserved with that of the tad loci found in Streptomyces coelicolor and Ralstonia solanacearum.
KEGG pathway
Sequence feature
References	Merops:M24A Family/Domain:IPR000045

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=6e-15 Q1K2W9_DESAC Prepilin peptidase Alignment 2 E=2e-14 Q3CFI6_THEET Peptidase A24A, prepilin type IV Alignment 3 E=1e-13 Q0ERQ6_THEET Peptidase A24A, prepilin type IV Alignment 4 E=3e-13 Q8RAF7_THETN Signal peptidase, cleaves prepilin-like proteins Alignment 5 E=3e-13 Q3A2M9_PELCD Type 4 prepilin peptidase 1. Aspartic peptidase. MEROPS family A24A Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR000045 Peptidase A24A, prepilin type IV (Domain) PF01478   Peptidase_A24 IPR000045 Peptidase A24A, prepilin type IV (Family) PR00864   PREPILNPTASE PF01478   Peptidase_A24 IPR014032 Peptidase A24A, prepilin type IV, bacterial (Domain) PR00864   PREPILNPTASE
SignalP	No significant hit
TMHMM	Transmembrane 5
SOSUI	Transmembrane 5

size of protein	151 amino acids
molecular mass	16,562.41 Da
pI	9.79
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 7.9 (12aa) 11.3 (17aa) 17.9 (27aa) 8.6 (13aa) 2 (3aa) 2.6 (4aa) 4 (6aa) 7.9 (12aa) 9.9 (15aa) 5.3 (8aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 3.3 (5aa) 0.7 (1aa) 0.7 (1aa) 1.3 (2aa) 5.3 (8aa) 3.3 (5aa) 1.3 (2aa) 3.3 (5aa) 2 (3aa) 1.3 (2aa)

>BBR47_05670 hypothetical membrane protein
ATGTTGTTATCCATGTATGTCATCATTCCCATTCTTTTCGTAATGGTAGTCGCTATGTAT
ACCGACCTGCGCAGTCGTCTCATTTACGACTGGCTGACGCTTCCGGGAATCGTATATTTT
CTCCTCGTGCATGCGTGCCTTCATCCGGAAAAATGGCTATCCTATGCGATGGGCGCTATC
GTGCTGGGCGGAATCTCACTGCTCATGGCGGTAATCAGTAAAGGGCAGATGGGCGGAGGC
GATATCAAGCTGCTGGCTTTGGTGGGAGCGGCGGTTGGATGGCAAGCGGGATTGGTCGTA
CTCATGCTTACGTATTTGCTCGCGGGAGTCAGTGTACTTCCCATATGGGTCATATCCAAG
ATGACGGGCAGAATGAAGCTTAACCGAGAGATACCACTGGCGCCATTTATCGCTGGAGGA
ACCAGTCTAATGCTGGTCATGGTTAGGTATTACTAG


>BBR47_05670 hypothetical membrane protein
MLLSMYVIIPILFVMVVAMYTDLRSRLIYDWLTLPGIVYFLLVHACLHPEKWLSYAMGAI
VLGGISLLMAVISKGQMGGGDIKLLALVGAAVGWQAGLVVLMLTYLLAGVSVLPIWVISK
MTGRMKLNREIPLAPFIAGGTSLMLVMVRYY

NBRC No.	clone name	start	stop	length(bp)
G10-001-021	BB1FE1L10034H02	570,921	607,128	36,208
G10-001-022	BB1FE1L10030A02	583,033	620,491	37,459

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.