CDS Information : BBR47_07170

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	758,824 / 759,024 / +
Location	758824..759024
Type	CDS
Length	201 bp (66 aa)

Product	hypothetical protein
Gene name
Functional category	Similar to unknown proteins - Partially similar to unknown proteins
EC number
Note
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=9e-07 Q83ZG9_STRDY Putative transposase Alignment 2 E=1e-05 O31103_ENTFC Transposase Alignment 3 E=1e-05 Q9AKZ8_ENTFA Putative transposase Alignment 4 E=9e-05 A8MFT0_ALKOO Integrase catalytic region Alignment 5 E=9e-05 A8MLZ0_ALKOO Integrase catalytic region Alignment
HAMAP	No significant hit
InterPro	No significant hit
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	66 amino acids
molecular mass	7,674.57 Da
pI	4.75
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 12.1 (8aa) 4.5 (3aa) 4.5 (3aa) 6.1 (4aa) 4.5 (3aa) 0 (0aa) 3 (2aa) 3 (2aa) 1.5 (1aa) 6.1 (4aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 3 (2aa) 1.5 (1aa) 6.1 (4aa) 4.5 (3aa) 6.1 (4aa) 7.6 (5aa) 1.5 (1aa) 6.1 (4aa) 6.1 (4aa) 12.1 (8aa)

>BBR47_07170 hypothetical protein
GTGAAAAGAGAACCAGCGTTTGAAAATGAAGAACGATATTTTAAAGCAAGCCGCGCTGAT
CATGGGACGAAAGTAGCTATCATCCAGAACAACCTTGATAAATACTCGGTATCAGCAATG
TGCGACGTCCTGCAAATCGCAAGAAGTACATTTTACTATGAAGCGAAAGAACAACCGAAC
GAAGACGCTCTAGAGATCTGA


>BBR47_07170 hypothetical protein
MKREPAFENEERYFKASRADHGTKVAIIQNNLDKYSVSAMCDVLQIARSTFYYEAKEQPN
EDALEI

NBRC No.	clone name	start	stop	length(bp)
G10-001-027	BB1FE1L10014F05	734,082	767,682	33,601
G10-001-028	BB1FE1L10018G09	755,660	792,561	36,902

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.