CDS Information : BBR47_07990

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	847,655 / 847,362 / -
Location	complement(847362..847655)
Type	CDS
Length	294 bp (97 aa)

Product	putative spore coat protein F
Gene name	yraD
Functional category	Cell envelope and cellular processes - Sporulation
EC number
Note	yraD in Bacillus subtilis.
KEGG pathway
Sequence feature
References	Family/Domain:IPR012851

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=3e-33 A7Z1V3_BACA2 YraD Alignment 2 E=5e-31 O06010_BACSU Spore coat protein F YraD protein Alignment 3 E=3e-27 Q2BDD9_9BACI Putative uncharacterized protein Alignment 4 E=1e-23 Q65JC0_BACLD YraD Alignment 5 E=2e-22 Q97LE8_CLOAB Spore coat protein F Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR012851 Coat F (Domain) PF07875   Coat_F IPR012851 Coat F (Family) PF07875   Coat_F
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	97 amino acids
molecular mass	10,793.44 Da
pI	4.53
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 9.3 (9aa) 2.1 (2aa) 13.4 (13aa) 10.3 (10aa) 0 (0aa) 2.1 (2aa) 3.1 (3aa) 5.2 (5aa) 7.2 (7aa) 4.1 (4aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 8.2 (8aa) 0 (0aa) 3.1 (3aa) 7.2 (7aa) 3.1 (3aa) 4.1 (4aa) 3.1 (3aa) 2.1 (2aa) 4.1 (4aa) 8.2 (8aa)

>BBR47_07990 putative spore coat protein F
ATGACTGGCATTCTTCAAAGCTTAGCTGGTATGGGTGGCCTGACGGATCAAGTAATCGCC
ATGGACCTTCTCATCTCCGCAAAGAGCGGTGTACGGAATTATGCGATGGCACTGACAGAA
ACAGGCACCCCAGAAATTAAGGCAACACTAACCAAGCAATTGGAAGAAGCAATCGATTTG
CACGAAAAGATCAGCCTATACATGATTGAGCGAGGCTGGTACCATCCATGGAATATTGCC
GAGCAGATTGAATTGGATCAGCAAAATATCCAGACCGCGTTACATCTTCCGTGA


>BBR47_07990 putative spore coat protein F
MTGILQSLAGMGGLTDQVIAMDLLISAKSGVRNYAMALTETGTPEIKATLTKQLEEAIDL
HEKISLYMIERGWYHPWNIAEQIELDQQNIQTALHLP

NBRC No.	clone name	start	stop	length(bp)
G10-001-030	BB1FE1L10004H11	813,537	851,996	38,460
G10-001-031	BB1FE1L10003F02	842,330	881,825	39,496

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.