CDS Information : BBR47_45660

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	4,831,867 / 4,832,091 / +
Location	4831867..4832091
Type	CDS
Length	225 bp (74 aa)

Product	hypothetical protein
Gene name
Functional category	No similarity
EC number
Note
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:13.0	No significant hit
HAMAP	No significant hit
InterPro	No significant hit
SignalP	No significant hit
TMHMM	Transmembrane 1
SOSUI	Transmembrane 1

size of protein	74 amino acids
molecular mass	8,673.57 Da
pI	8.89
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 2.7 (2aa) 8.1 (6aa) 17.6 (13aa) 6.8 (5aa) 12.2 (9aa) 0 (0aa) 2.7 (2aa) 5.4 (4aa) 4.1 (3aa) 6.8 (5aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 5.4 (4aa) 4.1 (3aa) 0 (0aa) 2.7 (2aa) 4.1 (3aa) 4.1 (3aa) 2.7 (2aa) 5.4 (4aa) 2.7 (2aa) 2.7 (2aa)

>BBR47_45660 hypothetical protein
GTGTTGGGGAAGCCCTGCCACATGTTTTCCAGTCGCCTGTATCCTCTCTACGTTCGGGCG
GTCTCCTTCCAAACATGTGACAGGGCTTTCGAGCTGTTAACGTTCATCGAGCTTTTCAAA
TCGTTTTTGGGATTGGTCATGGTAGATTTCTTGTGCTTACTGATCATCTTGAGTTATCGA
ATCATGATCGTGAAGCATTTTGGGTTCGTTTTGACGACTCAATGA


>BBR47_45660 hypothetical protein
MLGKPCHMFSSRLYPLYVRAVSFQTCDRAFELLTFIELFKSFLGLVMVDFLCLLIILSYR
IMIVKHFGFVLTTQ

NBRC No.	clone name	start	stop	length(bp)
G10-001-177	BB1FE1L10032E10	4,794,503	4,837,451	42,949
G10-001-178	BB1FE1L10025B03	4,825,651	4,867,035	41,385

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.