CDS Information : BBR47_48930

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	5,143,667 / 5,144,179 / +
Location	5143667..5144179
Type	CDS
Length	513 bp (170 aa)

Product	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Gene name	mtnD Synonym: ykrZ
Functional category	Intermediary metabolism - Metabolism of amino acids and related molecules
EC number
Note	ykrZ in Bacillus subtilis.
KEGG pathway
Sequence feature
References	Uniprot:O31669 Pubmed:14551435,12022921,15102328

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=2e-57 A7GS63_BACCN Acireductone dioxygenase ARD Alignment 2 E=2e-56 A9VFE2_9BACI Acireductone dioxygenase ARD Alignment 3 E=2e-55 Q4MTN3_BACCE ARD/ARD' family protein Alignment 4 E=2e-55 Q635P0_BACCZ Possible 5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase Alignment 5 E=2e-55 A0RI45_BACAH 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR004313 Acireductone dioxygenase, ARD (Family) PTHR23418   ACIREDUCTONE DIOXYGENASE PF03079   ARD IPR011051 Cupin, RmlC-type (Domain) SSF51182   RmlC-like cupins IPR014710 RmlC-like jelly roll fold (Domain) G3DSA:2.60.120.10   no description
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	170 amino acids
molecular mass	19,862.29 Da
pI	4.66
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 4.7 (8aa) 5.3 (9aa) 7.1 (12aa) 8.8 (15aa) 5.3 (9aa) 1.2 (2aa) 5.3 (9aa) 1.2 (2aa) 5.3 (9aa) 3.5 (6aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 4.7 (8aa) 1.2 (2aa) 2.9 (5aa) 2.4 (4aa) 4.7 (8aa) 6.5 (11aa) 4.1 (7aa) 5.9 (10aa) 11.2 (19aa) 8.8 (15aa)

>BBR47_48930 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
ATGGCACAAATTCGTTTTCACGACAACAATGAGTACATCTCCGCACCCGAGGAAGTTGTC
TCCTTCCTGGATACCCAAGAGATCATTTACGAAAAATGGGGCGTGGATCGCCTTGATCCA
AAGCACCGTGATAACTACAGCCCGACAGACGAGGAAAAACAAGAGATTCTCGACACCTTT
AAGCCAGAAATCGATGCGATTAGCCAACGTCGCGGTTACTTGACAGCGGACATTATCGTT
CTCTCTGACAAAACACCTAACCTCGACGAGCTGTTGGTAAAATTCAAGGGCGAGCATCAC
CACACCGACGATGAATGCCGCTTCTGCGTCGATGGTCACGGTATTTTCGCCATCAAAGGC
AAAGACGGACGCTACTTCGACGTCGAGCTGGAGCCAGGCGATCTGATCTCCGTACCACCG
AACTACCGCCACTACTTCACTCTGATGGACGACCGCAAAATCAAGGCGATTCGCCTGTTC
GTCACTCCTGCAGGCTGGGAAGCGATCTATTAA


>BBR47_48930 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
MAQIRFHDNNEYISAPEEVVSFLDTQEIIYEKWGVDRLDPKHRDNYSPTDEEKQEILDTF
KPEIDAISQRRGYLTADIIVLSDKTPNLDELLVKFKGEHHHTDDECRFCVDGHGIFAIKG
KDGRYFDVELEPGDLISVPPNYRHYFTLMDDRKIKAIRLFVTPAGWEAIY

NBRC No.	clone name	start	stop	length(bp)
G10-001-189	BB1FE1L10026A09	5,119,141	5,155,081	35,941
G10-001-190	BB1FE1L10020H03	5,142,421	5,181,031	38,611

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.