CDS Information : BBR47_49090

Display	1000bp 10000bp 100000bp Clone

Brevibacillus brevis NBRC 100599 chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Brevibacillus brevis NBRC 100599
Replicon	chromosome
Start / Stop / Direction	5,161,753 / 5,162,085 / +
Location	5161753..5162085
Type	CDS
Length	333 bp (110 aa)

Product	conserved hypothetical protein
Gene name	yusN
Functional category	Similar to unknown proteins - Homologous to unknown proteins
EC number
Note	yusN in Bacillus subtilis.
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:13.0 show BLAST table	1 E=1e-29 A4ISK5_GEOTN Putative uncharacterized protein Alignment 2 E=2e-28 Q5KVI9_GEOKA Hypothetical conserved protein Alignment 3 E=6e-28 Q9K780_BACHD BH3490 protein Alignment 4 E=1e-26 A6CTZ8_9BACI Putative uncharacterized protein Alignment 5 E=3e-26 Q2AG39_9FIRM Putative uncharacterized protein Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR012851 Coat F (Domain) PF07875   Coat_F IPR012851 Coat F (Family) PF07875   Coat_F
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	110 amino acids
molecular mass	12,852.27 Da
pI	5.55
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 8.2 (9aa) 1.8 (2aa) 9.1 (10aa) 2.7 (3aa) 4.5 (5aa) 0.9 (1aa) 4.5 (5aa) 3.6 (4aa) 3.6 (4aa) 4.5 (5aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 3.6 (4aa) 1.8 (2aa) 8.2 (9aa) 16.4 (18aa) 6.4 (7aa) 4.5 (5aa) 2.7 (3aa) 2.7 (3aa) 6.4 (7aa) 3.6 (4aa)

>BBR47_49090 conserved hypothetical protein
ATGCCAAACCAAAACCAGATCGCCAATCCACAATCCGGTCAGCTGCCACAAGTAAAAGGT
CCGCAAATGAACGATCGTGATTATCTCAACGATTGTTTAGCTACCTGCAAATACTTGACA
GATAACTTTAACATCGCCGTTCGTGAAGCCAGCCACCAGCAGCTTTATGATGACATGCTG
CAAATTTTGAATGAAACCCATCAATCAGCCCGCGATGCTTTCAATCTCATGTTCCAAAAG
GGATGGTACAAGCTGGAGGCTGCCGAGCAGCAAAAACTCCAGCAAGCTTATCAGCAATTT
AGCGGGTACTCCACGCAGTTCCCTTATCATTGA


>BBR47_49090 conserved hypothetical protein
MPNQNQIANPQSGQLPQVKGPQMNDRDYLNDCLATCKYLTDNFNIAVREASHQQLYDDML
QILNETHQSARDAFNLMFQKGWYKLEAAEQQKLQQAYQQFSGYSTQFPYH

NBRC No.	clone name	start	stop	length(bp)
G10-001-190	BB1FE1L10020H03	5,142,421	5,181,031	38,611

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.