CDS Information : DMR_42170

Display	1000bp 10000bp 100000bp Clone

Desulfovibrio magneticus RS-1 (= NBRC 104933) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Desulfovibrio magneticus RS-1 (= NBRC 104933)
Replicon	chromosome
Start / Stop / Direction	4,767,568 / 4,767,909 / +
Location	4767568..4767909
Type	CDS
Length	342 bp (113 aa)

Product	ATP synthase subunit c
Gene name	atpE
Functional category	Metabolism - Energy Metabolism
EC number	3.6.3.14
Note
KEGG pathway	map:00193 KO:K02110
Sequence feature
References

BLASTP Database:UniProtKB:14.0 show BLAST table	1 E=1e-32 A1VF67_DESVV ATP synthase F0, C subunit precursor Alignment 2 E=1e-29 Q30XU9_DESDG ATP synthase F0, C subunit precursor Alignment 3 E=4e-27 Q72DL2_DESVH ATP synthase C chain Alignment 4 E=2e-25 Q1MPG5_LAWIP ATP synthase C chain Alignment 5 E=1e-21 A8ZUM8_DESOH ATP synthase C chain Alignment
HAMAP	No significant hit
InterPro Database:interpro:18.0	IPR000454 ATPase, F0 complex, subunit C (Family) PS00605   ATPASE_C IPR002379 ATPase, F0/V0 complex, subunit C (Domain) SSF81333   F1F0 ATP synthase subunit C G3DSA:1.20.20.10   no description PF00137   ATP-synt_C IPR002379 ATPase, F0/V0 complex, subunit C (Family) G3DSA:1.20.20.10   no description PF00137   ATP-synt_C SSF81333   F1F0 ATP synthase subunit C IPR005953 ATPase, F0 complex, subunit C, bacterial and chloroplast (Family) TIGR01260   ATP_synt_c: ATP synthase F0, C subunit IPR020537 ATPase, F0 complex, subunit C, DCCD-binding site (Binding_site) PS00605   ATPASE_C
SignalP	Bacteria, Gram-negative
TMHMM	Transmembrane 3
SOSUI	Transmembrane 3

size of protein	113 amino acids
molecular mass	11,217.48 Da
pI	8.51
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 23 (26aa) 3.5 (4aa) 12.4 (14aa) 9.7 (11aa) 5.3 (6aa) 0.9 (1aa) 1.8 (2aa) 4.4 (5aa) 13.3 (15aa) 2.7 (3aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 8 (9aa) 2.7 (3aa) 0.9 (1aa) 0.9 (1aa) 0.9 (1aa) 3.5 (4aa) 0.9 (1aa) 1.8 (2aa) 0.9 (1aa) 2.7 (3aa)

>DMR_42170 ATP synthase subunit c
ATGCGTAAGGCTTTCATGACCATCTTCGCGACCGCTGCCCTGCTCGCCCTTGCTTCCGTG
GCCTTCGCCGCCGACACCGCCGGCGCCATGGGCGCCATCGGCACCATCTCCTGGGCCACC
GCCATCGGCATGGGCCTGGCCGCCGCCGGCTGCGGTCTTGGTCAGGGTCTGGGCCTGAAG
GCCGCCTGCGAAGGCACCGCTCGCAACCCCGAGGCCGGCGGCAAAATCACCGTCACCCTG
ATCCTCGGCATGGCCTTCATCGAATCCCTGGCCATTTACGCCCTGGTCGTCTGCCTGATC
CTGCTCTTCGCCCACCCCTTCGCGAAGATCATCACCGGCTAA


>DMR_42170 ATP synthase subunit c
MRKAFMTIFATAALLALASVAFAADTAGAMGAIGTISWATAIGMGLAAAGCGLGQGLGLK
AACEGTARNPEAGGKITVTLILGMAFIESLAIYALVVCLILLFAHPFAKIITG

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.