CDS Information : KRH_00290

Display	1000bp 10000bp 100000bp Clone

Kocuria rhizophila DC2201 (= NBRC 103217) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Kocuria rhizophila DC2201 (= NBRC 103217)
Replicon	chromosome
Start / Stop / Direction	35,564 / 35,301 / -
Location	complement(35301..35564)
Type	CDS
Length	264 bp (87 aa)

Product	hypothetical protein
Gene name
Functional category	Unclassified - hypothetical protein (prediction only)
EC number
Note
KEGG pathway
Sequence feature
References

UniProt	B2GIY5
INSD	BAG28376.1 (DDBJ GenBank EMBL)
UniParc	UPI0001733DA2

BLASTP Database:UniProtKB:12.5	No significant hit
HAMAP	No significant hit
InterPro	No significant hit
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	87 amino acids
molecular mass	9,428.56 Da
pI	8.46
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 9.2 (8aa) 10.3 (9aa) 3.4 (3aa) 3.4 (3aa) 5.7 (5aa) 1.1 (1aa) 3.4 (3aa) 3.4 (3aa) 6.9 (6aa) 11.5 (10aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 11.5 (10aa) 1.1 (1aa) 4.6 (4aa) 2.3 (2aa) 4.6 (4aa) 3.4 (3aa) 0 (0aa) 5.7 (5aa) 8 (7aa) 0 (0aa)

>KRH_00290 hypothetical protein
GTGGTCAAGTCTTTCGACATCAATCTGACCTGGTCAGCGGCCCGGGACTCGGTGGCGGTG
TACACCACCGACGCCACCGGTTGCCAGATGTTCAACAGCGGGTCGTCGTCACGCTTTCCC
GTCTACTACACGGGTGTGGTTGCAATGACGGATTCCGACGTGGCCAGAGGCAGCAAGAGA
ATTCGCACATTCGCCGACATCGCGGTCACCCTCAGCAATGGCCAGACATTGAACAAGACC
CCTCCAGTCGATTACTTCGGGTAG


>KRH_00290 hypothetical protein
MVKSFDINLTWSAARDSVAVYTTDATGCQMFNSGSSSRFPVYYTGVVAMTDSDVARGSKR
IRTFADIAVTLSNGQTLNKTPPVDYFG

NBRC No.	clone name	start	stop	length(bp)
G09-001-002	MDFO1S8502J22	24,628	62,283	37,656
G09-002-001	MDFO1S8501K15	2,744	37,820	35,077

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.