CDS Information : KRH_00300

Display	1000bp 10000bp 100000bp Clone

Kocuria rhizophila DC2201 (= NBRC 103217) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Kocuria rhizophila DC2201 (= NBRC 103217)
Replicon	chromosome
Start / Stop / Direction	35,689 / 36,174 / +
Location	35689..36174
Type	CDS
Length	486 bp (161 aa)

Product	putative MarR family transcriptional regulator
Gene name
Functional category	Genetic Information Processing - Transcription
EC number
Note	Belongs to the MarR transcriptional regulator family, which includes the multiple antibiotic resistance protein MarR of Escherichia coli (P27245), the transcriptional regulator SlyA of Escherichia coli (P0A8W2) and the organic hydroperoxide resistance transcriptional regulator OhrR of Bacillus subtilis (O34777).
KEGG pathway
Sequence feature
References	Family/Domain:marR_DBD

UniProt	B2GIY6
INSD	BAG28377.1 (DDBJ GenBank EMBL)
UniParc	UPI0001733DA3

BLASTP Database:UniProtKB:12.5 show BLAST table	1 E=3e-29 A1SIC5_NOCSJ Regulatory protein, MarR Alignment 2 E=7e-28 A1RB26_ARTAT Putative transcriptional regulator, MarR family Alignment 3 E=2e-27 A6W6G2_KINRA Transcriptional regulator, MarR family Alignment 4 E=1e-25 A6WBD4_KINRA Transcriptional regulator, MarR family Alignment 5 E=2e-25 Q3WH38_9ACTO Regulatory protein, MarR Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR000835 Bacterial regulatory protein, MarR (Family) SM00347   no description PF01047   MarR PS50995   HTH_MARR_2 IPR011991 Winged helix repressor DNA-binding (Domain) G3DSA:1.10.10.10   no description
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	161 amino acids
molecular mass	17,988.50 Da
pI	6.53
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 11.2 (18aa) 8.7 (14aa) 11.2 (18aa) 3.7 (6aa) 1.2 (2aa) 1.2 (2aa) 3.1 (5aa) 3.7 (6aa) 5 (8aa) 8.7 (14aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 4.3 (7aa) 0.6 (1aa) 2.5 (4aa) 3.1 (5aa) 0.6 (1aa) 1.9 (3aa) 2.5 (4aa) 11.8 (19aa) 4.3 (7aa) 10.6 (17aa)

>KRH_00300 putative MarR family transcriptional regulator
ATGACTGAGACGAAGTGGCTGTCCGAGGACGAGCGGGAGGCGTGGCTCGCGCTCGTGTCG
ATCATGTTCCGTCTGCCGGGATCCGTGGAGGGTCAGCTGCGCAGCGAGGAGGACATGTCC
CTGGCCGAGTACCTGGTGCTGGCCATGCTGTCCGAGGCTCCGAACCACCGGCACAAGATG
TCGGCGCTGGCCACCGCCACGAACACGTCCCAGTCGCGGCTGTCCCGCATCGTCGCCCGC
ATGGAGCGGGACGGTCTGGTCACCCGGGAGGGCCGCCAGGACGACCGCCGCGTGGTGATC
GCTGAGATCACCTCCGCCGGCCTGGAGCGGGTCAAGGAGGCCGCGCCGGCGCACGTGCGC
CACGTGCGGGAGATCGTCTTCGACCGGCTCAGCCCCGAGCAGGTGGTGCAGCTGCGCGAG
ATCGGCCGCGCCCTCAACTCCGGGGCCAACGCCCGCAGCGTGCTCGGGCTGGACTGCCCC
GCCTGA


>KRH_00300 putative MarR family transcriptional regulator
MTETKWLSEDEREAWLALVSIMFRLPGSVEGQLRSEEDMSLAEYLVLAMLSEAPNHRHKM
SALATATNTSQSRLSRIVARMERDGLVTREGRQDDRRVVIAEITSAGLERVKEAAPAHVR
HVREIVFDRLSPEQVVQLREIGRALNSGANARSVLGLDCPA

NBRC No.	clone name	start	stop	length(bp)
G09-001-002	MDFO1S8502J22	24,628	62,283	37,656
G09-002-001	MDFO1S8501K15	2,744	37,820	35,077

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.