CDS Information : KRH_02850

Display	1000bp 10000bp 100000bp Clone

Kocuria rhizophila DC2201 (= NBRC 103217) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Kocuria rhizophila DC2201 (= NBRC 103217)
Replicon	chromosome
Start / Stop / Direction	318,224 / 318,514 / +
Location	318224..318514
Type	CDS
Length	291 bp (96 aa)

Product	hypothetical protein
Gene name
Functional category	Unclassified - hypothetical protein (prediction only)
EC number
Note
KEGG pathway
Sequence feature
References

UniProt	B2GFF2
INSD	BAG28632.1 (DDBJ GenBank EMBL)
UniParc	UPI00017340FF

BLASTP Database:UniProtKB:12.5	No significant hit
HAMAP	No significant hit
InterPro	No significant hit
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	96 amino acids
molecular mass	10,414.86 Da
pI	11.85
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 13.5 (13aa) 8.3 (8aa) 10.4 (10aa) 2.1 (2aa) 1 (1aa) 2.1 (2aa) 8.3 (8aa) 1 (1aa) 10.4 (10aa) 7.3 (7aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 2.1 (2aa) 0 (0aa) 0 (0aa) 1 (1aa) 1 (1aa) 1 (1aa) 0 (0aa) 17.7 (17aa) 8.3 (8aa) 4.2 (4aa)

>KRH_02850 hypothetical protein
GTGCGGGCGCTGCCGGAGGGGAAGCTGCAGCGCGTCGCGGATGCGTGGCCGGATCTCCGT
GACGAGGGCGGGGTGGACGTCGCGCTCGTCCGACCCAGCCTCGTCCGGTGGTCGGGCGGA
TCCACCATCCGCGCCTCGGAGGACGGGCCCGCCGCGCGACGGGAGGCGCCCCTCCCGCCG
TCCCTGCGGGACCGGATTGCCGTGCGCTCCAGGCTCCGGGGCGCGGGTCCTGCGCTCCGG
GCCACGGTCGACGACGCGGGGTACCGCCTGCGGGGCGTGTTCCGTTCCTGA


>KRH_02850 hypothetical protein
MRALPEGKLQRVADAWPDLRDEGGVDVALVRPSLVRWSGGSTIRASEDGPAARREAPLPP
SLRDRIAVRSRLRGAGPALRATVDDAGYRLRGVFRS

NBRC No.	clone name	start	stop	length(bp)
G09-002-008	MDFO1S8502D11	283,343	323,005	39,663
G09-002-009	MDFO1S8502J05	314,779	346,611	31,833

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.