CDS Information : KRH_10460

Display	1000bp 10000bp 100000bp Clone

Kocuria rhizophila DC2201 (= NBRC 103217) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Kocuria rhizophila DC2201 (= NBRC 103217)
Replicon	chromosome
Start / Stop / Direction	1,142,524 / 1,142,727 / +
Location	1142524..1142727
Type	CDS
Length	204 bp (67 aa)

Product	50S ribosomal protein L32
Gene name	rpmF
Functional category	Genetic Information Processing - Translation
EC number
Note
KEGG pathway	map:03010 KO:K02911
Sequence feature
References	HAMAP:MF_00340

UniProt	B2GFM0
INSD	BAG29393.1 (DDBJ GenBank EMBL)
UniParc	UPI0001733F7D

BLASTP Database:UniProtKB:12.5 show BLAST table	1 E=2e-25 RL32_ARTAT 50S ribosomal protein L32 Alignment 2 E=7e-25 RL32_ARTS2 50S ribosomal protein L32 Alignment 3 E=3e-24 A5CQP8_CLAM3 RpmF protein Alignment 4 E=5e-24 A4AL52_9ACTN 50S ribosomal protein L32 Alignment 5 E=8e-24 RL32_LEIXX 50S ribosomal protein L32 Alignment
HAMAP Database:HAMAP:20070519	MF_00340   RL32
InterPro Database:interpro:16.0	IPR002677 Ribosomal L32p protein (Family) PF01783   Ribosomal_L32p TIGR01031   rpmF_bact: ribosomal protein L32
SignalP	Bacteria, Gram-positive
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	67 amino acids
molecular mass	7,564.82 Da
pI	11.3
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 11.9 (8aa) 9 (6aa) 6 (4aa) 0 (0aa) 1.5 (1aa) 1.5 (1aa) 6 (4aa) 4.5 (3aa) 4.5 (3aa) 9 (6aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 4.5 (3aa) 0 (0aa) 3 (2aa) 4.5 (3aa) 4.5 (3aa) 13.4 (9aa) 1.5 (1aa) 9 (6aa) 3 (2aa) 3 (2aa)

>KRH_10460 50S ribosomal protein L32
GTGGCTGTTCCCAAGCGGAAAATGTCCCGTGCGAATACCCGGATGCGCCGGTCCCAGTGG
AAGGCTCAGGCCCCCAAACTGGTGAAGACCGTGGAGAACGGCAAGGTCAGCTACAGCCTG
CCGCACCAGGCCAAGCTGGTCTCCGATTCCGCCGGCACCCCCTTGTTCTACGAGTACAAG
GGCCGCAAGGTCGCTGACGCGTAA


>KRH_10460 50S ribosomal protein L32
MAVPKRKMSRANTRMRRSQWKAQAPKLVKTVENGKVSYSLPHQAKLVSDSAGTPLFYEYK
GRKVADA

NBRC No.	clone name	start	stop	length(bp)
G09-002-028	MDFO1S8502F18	1,110,843	1,154,649	43,807
G09-002-029	MDFO1S8503I17	1,129,364	1,163,679	34,316

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.