CDS Information : KRH_13380

Display	1000bp 10000bp 100000bp Clone

Kocuria rhizophila DC2201 (= NBRC 103217) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Kocuria rhizophila DC2201 (= NBRC 103217)
Replicon	chromosome
Start / Stop / Direction	1,506,816 / 1,506,400 / -
Location	complement(1506400..1506816)
Type	CDS
Length	417 bp (138 aa)

Product	transcription antitermination protein NusB
Gene name	nusB
Functional category	Genetic Information Processing - Transcription
EC number
Note	Involved in the regulation of ribosomal RNA transcription.
KEGG pathway	KO:K03625
Sequence feature
References	Uniprot:P95020 Pubmed:11170413,10881194

UniProt	B2GI93
INSD	BAG29685.1 (DDBJ GenBank EMBL)
UniParc	UPI00017343B9

BLASTP Database:UniProtKB:12.5 show BLAST table	1 E=1e-45 A1R700_ARTAT Transcription antitermination factor NusB Alignment 2 E=7e-44 A0JX79_ARTS2 NusB antitermination factor Alignment 3 E=3e-38 NUSB_THEFY N utilization substance protein B homolog Protein nusB Alignment 4 E=5e-34 A1SJD8_NOCSJ Transcription antitermination factor NusB Alignment 5 E=4e-33 A3TLR3_9MICO NusB antitermination factor Alignment
HAMAP Database:HAMAP:20070519	MF_00073   NUSB
InterPro Database:interpro:16.0	IPR006027 NusB/RsmB/TIM44 (Domain) G3DSA:1.10.940.10   no description SSF48013   NusB-like PF01029   NusB IPR011605 NusB antitermination factor (Family) TIGR01951   nusB: transcription antitermination factor
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	138 amino acids
molecular mass	15,486.36 Da
pI	4.61
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 9.4 (13aa) 10.1 (14aa) 10.1 (14aa) 3.6 (5aa) 2.2 (3aa) 1.4 (2aa) 4.3 (6aa) 1.4 (2aa) 5.8 (8aa) 8 (11aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 2.9 (4aa) 0 (0aa) 4.3 (6aa) 2.9 (4aa) 2.2 (3aa) 2.2 (3aa) 0 (0aa) 11.6 (16aa) 7.2 (10aa) 10.1 (14aa)

>KRH_13380 transcription antitermination protein NusB
GTGAGCGGGGCACGCAGCAAGGCGCGGGTGCGCGCCGTCGAGATCCTCTTCGAGGCCGAG
CAGCGCAACGAGTCCGTGCGTGACGCCCTGGTGCGCCGCCGCGAGAACTCGTCCTCGCCC
ATCAACCCGTACACCGTGGAGATCCTCGAGGGCGTGGACGAGCGCCGCGAGGACATCGAC
GAGTTCCTGGAGACCTACTCGCAGGGCTGGGCCCTCGGGCGGATGCCCGCGGTGGACCGC
AACGCGCTGCGCGTGGGCGCGTGGGAGCTGCTGTACAACAGCGAGATCCCGGACGGCGTG
GCCGTGGCCGAGGCGGTGGCCGTGACCCGGCAGCTGTCCACCGACGACTCACCGCGCTTC
GTCAACGGTCTGCTGGGGCGGCTGCAGAAGGTCAAGCCGTCCCTGCTGGACGACTGA


>KRH_13380 transcription antitermination protein NusB
MSGARSKARVRAVEILFEAEQRNESVRDALVRRRENSSSPINPYTVEILEGVDERREDID
EFLETYSQGWALGRMPAVDRNALRVGAWELLYNSEIPDGVAVAEAVAVTRQLSTDDSPRF
VNGLLGRLQKVKPSLLDD

NBRC No.	clone name	start	stop	length(bp)
G09-001-065	MDFO1S8501M17	1,487,133	1,516,135	29,003
G09-002-038	MDFO1S8503M18	1,503,502	1,544,172	40,671

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.