CDS Information : KRH_20030

Display	1000bp 10000bp 100000bp Clone

Kocuria rhizophila DC2201 (= NBRC 103217) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Kocuria rhizophila DC2201 (= NBRC 103217)
Replicon	chromosome
Start / Stop / Direction	2,300,859 / 2,301,227 / +
Location	2300859..2301227
Type	CDS
Length	369 bp (122 aa)

Product	putative GntR family transcriptional regulator
Gene name
Functional category	Genetic Information Processing - Transcription
EC number
Note	Belongs to the GntR transcriptional regulator family, which includes the gluconate operon transcriptional repressor GntR of Bacillus subtilis (P10585), the fatty acyl responsive regulator FarR of Escherichia coli (P13669) and the histidine utilization repressor HutC of Pseudomonas putida (P22773).
KEGG pathway
Sequence feature
References	Family/Domain:gntR_DBD

UniProt	B2GGY4
INSD	BAG30350.1 (DDBJ GenBank EMBL)
UniParc	UPI00017345CB

BLASTP Database:UniProtKB:12.5 show BLAST table	1 E=1e-21 Q5YPX9_NOCFA Putative transcriptional regulator Alignment 2 E=2e-18 Q0S4V0_RHOSR Possible transcriptional regulator Alignment 3 E=4e-18 Q47Q25_THEFY Regulatory protein GntR, HTH Alignment 4 E=7e-17 A5CNL3_CLAM3 Putative transcriptional regulator Alignment 5 E=9e-17 Q8KPW7_SACER Putative GntR family transcriptional regulator Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR000524 Bacterial regulatory protein GntR, HTH (Domain) PS50949   HTH_GNTR SM00345   no description PF00392   GntR IPR011991 Winged helix repressor DNA-binding (Domain) G3DSA:1.10.10.10   no description
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	122 amino acids
molecular mass	13,217.05 Da
pI	7.42
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 14.8 (18aa) 9.8 (12aa) 8.2 (10aa) 3.3 (4aa) 1.6 (2aa) 0 (0aa) 4.1 (5aa) 2.5 (3aa) 8.2 (10aa) 4.1 (5aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 7.4 (9aa) 1.6 (2aa) 0 (0aa) 3.3 (4aa) 3.3 (4aa) 1.6 (2aa) 1.6 (2aa) 11.5 (14aa) 5.7 (7aa) 7.4 (9aa)

>KRH_20030 putative GntR family transcriptional regulator
ATGTTCACGGTCGACCCCCACTCCACCACCCCGGTGTACGCGCAGCTCGTGGAGTGCGTG
CTGCGGGACGTCTCCACCGGCGAGCTCGTGGTGGGCGACCGCATCCCGCCGGTGCGCACA
CTCGCCTCCGAGCTCGGGCTCTCCGCCGGGACCGTGGCCAAGGCGTACCGGCAGATGGAA
ACCCGCGGGATCATCGAGACGCGCGGCCGGAAGGGCACGTTCATCGCGCAGGGCCGCGAC
GACCGGGAGGGCGCGGCGGCACGCGCGGCCGCCGCATACCTGGACGTGGTCGCGGGGCAG
CTGCACTACTCACCCGAGGAGTGCATGGCGCTGGTGGAGCGGGCGCTGGACAGGCGCGCG
GCGCGCTGA


>KRH_20030 putative GntR family transcriptional regulator
MFTVDPHSTTPVYAQLVECVLRDVSTGELVVGDRIPPVRTLASELGLSAGTVAKAYRQME
TRGIIETRGRKGTFIAQGRDDREGAAARAAAAYLDVVAGQLHYSPEECMALVERALDRRA
AR

NBRC No.	clone name	start	stop	length(bp)
G09-002-060	MDFO1S8503N16	2,271,852	2,309,075	37,224
G09-002-061	MDFO1S8503M02	2,299,580	2,340,118	40,539

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.