CDS Information : KRH_20790

Display	1000bp 10000bp 100000bp Clone

Kocuria rhizophila DC2201 (= NBRC 103217) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Kocuria rhizophila DC2201 (= NBRC 103217)
Replicon	chromosome
Start / Stop / Direction	2,387,116 / 2,386,754 / -
Location	complement(2386754..2387116)
Type	CDS
Length	363 bp (120 aa)

Product	putative GntR family transcriptional regulator
Gene name
Functional category	Genetic Information Processing - Transcription
EC number
Note	Belongs to the GntR transcriptional regulator family, which includes the gluconate operon transcriptional repressor GntR of Bacillus subtilis (P10585), the fatty acyl responsive regulator FarR of Escherichia coli (P13669) and the histidine utilization repressor HutC of Pseudomonas putida (P22773).
KEGG pathway
Sequence feature
References	Family/Domain:gntR_DBD

UniProt	B2GHF0
INSD	BAG30426.1 (DDBJ GenBank EMBL)
UniParc	UPI00017342D0

BLASTP Database:UniProtKB:12.5 show BLAST table	1 E=3e-24 Q0RJC4_FRAAA Putative transcriptional regulator GntR-family Alignment 2 E=3e-24 Q5Z2X7_NOCFA Putative transcriptional regulator Alignment 3 E=1e-23 A4AH46_9ACTN Putative transcriptional regulator Alignment 4 E=7e-23 A1R7S6_ARTAT Putative transcriptional regulator, gntR family Alignment 5 E=1e-20 Q5WCG8_BACSK GntR family transcriptional regulator Alignment
HAMAP	No significant hit
InterPro Database:interpro:16.0	IPR000524 Bacterial regulatory protein GntR, HTH (Domain) PF00392   GntR SM00345   no description PS50949   HTH_GNTR IPR011991 Winged helix repressor DNA-binding (Domain) G3DSA:1.10.10.10   no description
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	120 amino acids
molecular mass	13,131.95 Da
pI	5.16
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 13.3 (16aa) 6.7 (8aa) 9.2 (11aa) 6.7 (8aa) 4.2 (5aa) 0 (0aa) 6.7 (8aa) 2.5 (3aa) 7.5 (9aa) 3.3 (4aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 4.2 (5aa) 0 (0aa) 2.5 (3aa) 4.2 (5aa) 1.7 (2aa) 1.7 (2aa) 0.8 (1aa) 10.8 (13aa) 10 (12aa) 4.2 (5aa)

>KRH_20790 putative GntR family transcriptional regulator
ATGACACCCAGACAAGACGGTCGCCCGATCTTCATGGTCCTGGCCGATCAGATCGCGGAC
GACATCCTCCAGGGCAACTACCCGGTGGATTCCGCCGTGCCATCCACCAACGAACTCGCC
GCGTTCTACCGCATCAACCCCGCGACGGCGGGGAAAGCGCTGGGACGCTTGGTGGATCAG
GGAGTCTTGGAGCGGCGTCGTGGGATCGGGACGTTCGTGGCCGCGGATGGCCCGGACATC
CTGCGAGCGCAGCGCCGGGAGGCGTTCCACGAAGACTTCATCCGACCTGCCGTGGCCGAG
GCCCGGAGGCTCGGACTCACACTCGACGACATGGTCGCACTCATCAGCAAGGACTCGCCA
TGA


>KRH_20790 putative GntR family transcriptional regulator
MTPRQDGRPIFMVLADQIADDILQGNYPVDSAVPSTNELAAFYRINPATAGKALGRLVDQ
GVLERRRGIGTFVAADGPDILRAQRREAFHEDFIRPAVAEARRLGLTLDDMVALISKDSP

NBRC No.	clone name	start	stop	length(bp)
G09-001-105	MDFO1S8502C04	2,359,014	2,402,588	43,575
G09-002-063	MDFO1S8503M22	2,380,401	2,424,895	44,495

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.