CDS Information : MCP_0004

Display	1000bp 10000bp 100000bp Clone

Methanocella paludicola SANAET (= NBRC 101707T) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Methanocella paludicola SANAET (= NBRC 101707T)
Replicon	chromosome
Start / Stop / Direction	2,976 / 3,488 / +
Location	2976..3488
Type	CDS
Length	513 bp (170 aa)

Product	putative peroxiredoxin
Gene name
Functional category	Metabolism - Energy Metabolism
EC number
Note	This ORF product lacks an active site (cysteine residue) required for Cysteine sulfenic acid (-SOH) intermediate activity.
KEGG pathway
Sequence feature
References	Family/Domain:IPR000866

BLASTP Database:UniProtKB:15.0 show BLAST table	1 E=1e-41 Q0W5B4_UNCMA Peroxiredoxin-like bacterioferritin comigratory protein Alignment 2 E=5e-12 Q0W398_UNCMA Peroxiredoxin-like bacterioferritin comigratory protein Alignment 3 E=7e-12 Q0W265_UNCMA Peroxiredoxin-like bacterioferritin comigratory protein Alignment 4 E=9e-12 Q15Z82_PSEA6 Redoxin Alignment 5 E=1e-11 B2TCU1_BURPP Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Alignment
HAMAP	No significant hit
InterPro Database:interpro:18.0	IPR000866 Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen (Domain) PF00578   AhpC-TSA IPR012335 Thioredoxin fold (Domain) G3DSA:3.40.30.10   no description IPR012336 Thioredoxin-like fold (Domain) SSF52833   Thioredoxin-like IPR017936 Thioredoxin-like (Domain) PS51352   THIOREDOXIN_2
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	170 amino acids
molecular mass	18,880.57 Da
pI	5.04
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 8.8 (15aa) 9.4 (16aa) 10 (17aa) 1.8 (3aa) 4.7 (8aa) 1.2 (2aa) 7.6 (13aa) 2.4 (4aa) 8.2 (14aa) 5.3 (9aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 4.7 (8aa) 1.2 (2aa) 2.4 (4aa) 1.8 (3aa) 4.7 (8aa) 4.7 (8aa) 0.6 (1aa) 7.1 (12aa) 5.9 (10aa) 7.6 (13aa)

>MCP_0004 putative peroxiredoxin
ATGTACAAGCTGGTGCTGCGCCTGGACGTGGGGAGCCGGGCCGAGGATTTCACGCTCAAG
GACTTTAACGGGAACGCGGTCAGCCTGGGCAGCCTCATCGGCAGGGGCATCGTCTTCCTG
ACCTTTTACAGGGGCGGTTTCGACAAAGAGTCGGTCAGGTACCTGAGGGCGCTGGCCGAT
AATCACGAGAGGCTGAAGGACCTCGGGGTCGAGGTGGTCGCGGTCACGCCCGAGCTCCCC
GAAAAGGCGAGGGGCACTGCGGAGTCGCTAAGCCTGCCGTTCACGGTGCTGTGCGACCCG
GAGCTTACGGCGACGAAGCAGTACGACGTCTACGATCCATCGATGGAGTGGTGCTGGCCT
GCCGGTTTCGTGATAGGCGAGGACGGGGCCGTCCAGTACGTTTACCGCGGCGTGAGCCCG
CCCAACACTCCCCCTGTTCCATATTTAATGAAAAAGTTCGAGCAGATGCGCTCGCCGCCC
GAAGAGGCCGCCGGCAGGGCCGCGGCCCGCTAG


>MCP_0004 putative peroxiredoxin
MYKLVLRLDVGSRAEDFTLKDFNGNAVSLGSLIGRGIVFLTFYRGGFDKESVRYLRALAD
NHERLKDLGVEVVAVTPELPEKARGTAESLSLPFTVLCDPELTATKQYDVYDPSMEWCWP
AGFVIGEDGAVQYVYRGVSPPNTPPVPYLMKKFEQMRSPPEEAAGRAAAR

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.