CDS Information : MCP_0013

Display	1000bp 10000bp 100000bp Clone

Methanocella paludicola SANAET (= NBRC 101707T) chromosome	Legend Jump
Overview  Genome Clone

Center position		change
ID		change
Gene name		change

Organism	Methanocella paludicola SANAET (= NBRC 101707T)
Replicon	chromosome
Start / Stop / Direction	10,052 / 9,900 / -
Location	complement(9900..10052)
Type	CDS
Length	153 bp (50 aa)

Product	50S ribosomal protein L39e
Gene name	rpl39e
Functional category	Information Pathways - Translation
EC number
Note
KEGG pathway	map:03010 KO:K02924
Sequence feature
References	HAMAP:MF_00629

BLASTP Database:UniProtKB:15.0 show BLAST table	1 E=3e-13 RL39_METMJ 50S ribosomal protein L39e Alignment 2 E=2e-12 B8GEU4_9EURY Ribosomal protein L39e Alignment 3 E=2e-12 B7R1Y2_9EURY Ribosomal L39 protein Alignment 4 E=2e-12 B6YWY4_THEON LSU ribosomal protein L39E Alignment 5 E=5e-12 RL39_METBU 50S ribosomal protein L39e Alignment
HAMAP Database:HAMAP:20061004	MF_00629   RL39
InterPro Database:interpro:18.0	IPR000077 Ribosomal protein L39e (Family) PF00832   Ribosomal_L39 PTHR19970   RIBOSOMAL PROTEIN L39E G3DSA:1.10.1620.10   no description SSF48662   Ribosomal protein L39e IPR023626 Ribosomal protein L39e domain (Domain) G3DSA:1.10.1620.10   no description SSF48662   Ribosomal protein L39e
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	50 amino acids
molecular mass	6,007.19 Da
pI	12.74
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 8 (4aa) 6 (3aa) 4 (2aa) 4 (2aa) 0 (0aa) 4 (2aa) 6 (3aa) 6 (3aa) 2 (1aa) 6 (3aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 8 (4aa) 0 (0aa) 6 (3aa) 2 (1aa) 2 (1aa) 16 (8aa) 2 (1aa) 16 (8aa) 0 (0aa) 2 (1aa)

>MCP_0013 50S ribosomal protein L39e
ATGACGAAGAAGTCAAAGGGCAAGAAGATCCGGTTAGCCAAGTACGCTAACCAGAACAGA
AGAGTCCCGGCGTGGGTCATCATGAAGACCAACAGGGCCGTCATGACCCACCCGAAGCGC
AGGAGCTGGCGCAGGACCAGCCTACCCGAGTAA


>MCP_0013 50S ribosomal protein L39e
MTKKSKGKKIRLAKYANQNRRVPAWVIMKTNRAVMTHPKRRSWRRTSLPE

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.