CDS Information : PH0022.1

open/close all

Genomic map

Display

Pyrococcus horikoshii OT3^T (= NBRC 100139^T) chromosome

Legend Jump

Overview
Genome

Center position		change
ID		change
Gene name		change

Genome	Display	Sync
chromosome

Location

Organism	Pyrococcus horikoshii OT3^T (= NBRC 100139^T)
Replicon	chromosome
Start / Stop / Direction	21,917 / 20,823 / -
Location	complement(20823..21917)
Type	CDS
Length	1,095 bp (364 aa)

Annotation

Product

ABC transporter ATP binding protein

Gene name

Functional category

Membrane Transport

EC number

Note

KEGG pathway

Sequence feature

References

Uniprot:Q9YGA6 Pubmed:10400644
DOGAN:PH0022.1 Pubmed:15382245

Comparative genome

Table

Display	BBH1e-1001e-501e-101e-3

Pyrococcus abyssi GE5	Pyrococcus furiosus DSM 3638	Thermococcus kodakaraensis KOD1
[27] PAB2336 0(650) maltose/maltodextrin transport ATP-binding [192] PAB0123 9e-112(395) multiple sugar-binding transport ATP-binding protein MsmK(msmK) [199] PAB2232 2e-96(344) sugar transport ATP-binding protein [835] PAB0545 9e-70(256) ABC transporter ATP-binding protein [165] PAB0103 5e-57(213) ABC transporter, ATP-binding protein [775] PAB1875 8e-29(120) dipeptide ABC transporter, ATP-binding protein(dppF) [691] PAB1923 1e-28(119) daunorubicin resistance ATP-binding protein(drrA-1) [1860] PAB1197 3e-28(118) oligopeptide transport ATP-binding protein [157] PAB0095 5e-28(117) dipeptide ABC transporter, dipeptide-binding protein(dppF-1) [1096] PAB0700 4e-27(114) phosphate ABC transporter, ATP-binding protein(pstB) [387] PAB0249 8e-26(110) ABC transporter, ATP-binding protein [1060] PAB1696 7e-25(107) ABC transporter, ATP-binding protein [542] PAB0350 2e-24(105) ABC transporter ATP-binding protein [1046] PAB1703 6e-24(103) daunorubicin resistance ATP-binding protein DrrA [1630] PAB1347 2e-23(102) dipeptide ABC transporter, ATP-binding protein(dppF) [1861] PAB1196 4e-23(101) oligopeptide transport ATP-binding protein [661] PAB0434 4e-23(101) ATP-binding transport protein [814] PAB1845 2e-22(98.6) hypothetical protein [987] PAB0631 4e-22(97.8) oligopeptide transport ATP-binding protein AppF(appF-3) [156] PAB0094 7e-22(97.1) dipeptide ABC transporter, dipeptide-binding protein(dppD-1) [438] PAB2068 9e-22(96.7) daunorubicin resistance ATP-binding protein(drrA-2) [776] PAB1874 9e-19(86.7) peptide ABC transporter ATP-binding protein [1104] PAB1668 1e-18(86.3) ATP-binding transport protein [141] PAB2260 2e-18(85.9) cobalt ABC transporter, ATP-binding protein(cbiO) [1055] PAB0678 1e-17(83.2) iron (III) ABC transporter, ATP-binding protein(hemV-1) [1326] PAB0824 1e-17(82.8) putative ATPase RIL [473] PAB0303 2e-17(82.4) ribose ABC transporter, ATP-binding protein(rbsA) [1351] PAB1536 1e-15(76.6) iron (III) ABC transporter, ATP-binding protein(hemV-2) [1631] PAB1346 8e-15(73.6) dipeptide ABC transporter, ATP-binding protein(dppD) [986] PAB0630 8e-15(73.6) oligopeptide transport ATP-binding protein AppF(appF-2) [313] PAB2147 8e-15(73.6) ABC transporter, ATP-binding protein [797] PAB1855 4e-14(71.2) hypothetical protein [312] PAB2148 9e-11(60.1) ABC transporter ATP-binding protein [684] PAB1929 2e-08(52.4) ABC transporter ATP-binding protein	[2023] PF1970 5e-179(619) putative multiple sugar-binding transport ATP-binding protein [1984] PF1933 3e-114(404) putative sugar transport ATP-hydrolyzing [1793] PF1744 3e-105(374) trehalose/maltose transport ATP-hydrolyzing [116] PF0116 6e-96(343) putative multiple sugar transport protein [1566] PF1519 3e-77(281) sugar-binding transport ATP-binding protein [1799] PF1750 1e-69(255) putative sugar-binding transport ATP-binding protein [82] PF0082 4e-57(214) membrane protein [1044] PF1008 6e-29(120) putative ABC transport protein [596] PF0583 8e-29(120) daunorubicin resistance ATP-binding protein [197] PF0194 3e-28(118) dipeptide ABC transporter, ATP-binding protein [1459] PF1412 3e-27(115) dipeptide transport ATP-binding protein [316] PF0310 2e-24(105) daunorubicin resistance ATP-binding protein DrrA [1829] PF1779 6e-24(103) putative ABC transporter [1293] PF1249 8e-24(103) putative ABC transporter [1047] PF1011 8e-24(103) daunorubicin resistance ATP-binding protein DrrA [956] PF0921 1e-23(103) putative ABC transporter [1939] PF1889 1e-23(102) daunorubicin resistance ATP-binding protein DrrA [1254] PF1213 2e-23(102) oligopeptide ABC transporter [368] PF0361 2e-23(102) oligopeptide ABC transporter [35] PF0035 3e-23(101) daunorubicin resistance ATP-binding protein [196] PF0193 7e-23(100) putative ABC transport ATP binding protein [6] PF0006 3e-22(98.2) ABC transporter [940] PF0905 4e-22(97.8) putative ABC transporter [1702] PF1654 2e-21(95.5) ABC transporter [944] PF0909 6e-19(87.4) ferric enterobactin transport ATP-binding protein [862] PF0835 6e-18(84) daunorubicin resistance ATP-binding protein DrrA [68] PF0068 8e-18(83.6) cobalt transport ATP-binding protein [284] PF0279 1e-17(82.8) putative ABC transporter [686] PF0670 2e-17(82.4) putative ATPase RIL [1744] PF1696 2e-17(82) putative ABC sugar transporter [1458] PF1411 3e-17(81.6) dipeptide transport ATP-binding protein [1907] PF1857 1e-16(79.7) cobalt transport ATP-binding protein CbiO [540] PF0528 3e-16(78.6) cobalt transport ATP-binding protein [590] PF0577 8e-16(77) ATP-binding transport protein [913] PF0881 1e-15(76.3) putative ABC transporter [753] PF0732 1e-15(76.3) daunorubicin resistance ATP-binding protein [514] PF0502 1e-14(72.8) iron(III) dicitrate transport system permease protein FecE [1253] PF1212 4e-14(71.2) putative peptide ABC uptake protein [1514] PF1467 6e-13(67.4) putative ABC transporter [1331] PF1287 8e-13(67) putative ABC transporter [367] PF0360 1e-12(66.6) oligopeptide ABC transporter [1569] PF1522 2e-12(65.5) putative ABC transporter [1703] PF1655 4e-12(64.7) ABC transporter [755] PF0733 2e-11(62.4) putative ABC transporter [768] PF0744 3e-10(58.5) ABC transporter [1281] PF1238 2e-08(52.4) putative ABC transporter [5] PF0005 2e-07(49.3) ABC transporter, ATP-binding protein [928] PF0895 0.0009(37) putative ABC transporter	[1775] TK1775 1e-109(388) ABC-type maltodextrin transport system, ATPase component [572] TK0572 3e-83(301) ABC-type iron(III) transport system, ATPase component [158] TK0158 3e-73(268) ABC-type iron(III) transport system, ATPase component [21] TK0021 1e-53(202) ABC-type sulfate transport system, ATPase component [719] TK0719 6e-46(177) ABC-type molybdate transport system, ATPase component [1579] TK1579 5e-29(120) ABC-type multidrug transport system, ATPase component [727] TK0727 1e-28(119) ABC-type multidrug transport system, ATPase component [1868] TK1868 7e-28(117) ABC-type phosphate transport system, ATPase component [1144] TK1144 6e-27(114) ABC-type multidrug transport system, ATPase component [1800] TK1800 3e-26(111) ABC-type dipeptide/oligopeptide transport system, ATPase component [2281] TK2281 5e-26(110) ABC-type multidrug transport system, ATPase component [1859] TK1859 1e-25(109) lipoprotein releasing system, ATP-binding protein [942] TK0942 5e-24(104) ABC-type multidrug transport system, ATPase component [2053] TK2053 2e-23(102) ABC-type multidrug transport system, ATPase component [1106] TK1106 7e-23(100) ABC-type cobalt transport system, ATPase component [1756] TK1756 4e-22(98.2) ABC-type dipeptide/oligopeptide transport system, ATPase component [2026] TK2026 5e-22(97.8) ABC-type multidrug transport system, ATPase component [1801] TK1801 8e-22(97.1) ABC-type dipeptide/oligopeptide transport system, ATPase component [355] TK0355 2e-21(95.5) ABC-type multidrug transport system, ATPase component [1337] TK1337 5e-21(94.4) ABC-type sodium efflux pump system, ATPase component [2161] TK2161 2e-19(89.4) ABC-type multidrug transport system, ATPase component [803] TK0803 3e-19(88.6) ABC-type manganese/zinc transport system, ATPase component [1181] TK1181 9e-18(83.6) ABC-type cobalt transport system, ATPase component [1152] TK1152 2e-17(82.8) ABC-type multidrug transport system, ATPase component [746] TK0746 2e-17(82.4) ABC-type cobalt transport system, ATPase component [161] TK0161 3e-17(81.6) ABC-type multidrug transport system, ATPase component [694] TK0694 1e-15(76.6) ABC-type multidrug transport system, ATPase component [658] TK0658 1e-15(76.6) ABC-type transport system, ATPase component [1588] TK1588 1e-15(76.3) ABC-type multidrug transport system, ATPase component [1031] TK1031 2e-15(75.5) putative ATPase RIL [230] TK0230 5e-15(74.3) ABC-type multidrug transport system, ATPase component [731] TK0731 2e-14(72.8) ABC-type transport system involved in Fe-S cluster assembly, ATPase component [2020] TK2020 4e-14(71.6) ABC-type iron(III)-siderophore transport system, ATPase component [326] TK0326 4e-14(71.6) ABC-type multidrug transport system, ATPase component [1452] TK1452 2e-13(68.9) ABC-type multidrug transport system, ATPase and permease components [1757] TK1757 7e-13(67.4) ABC-type dipeptide/oligopeptide transport system, ATPase component [708] TK0708 1e-12(66.2) ABC-type iron(III)-siderophore transport system, ATPase component [2208] TK2208 7e-12(63.9) ABC-type iron(III)-siderophore transport system, ATPase component [1936] TK1936 8e-11(60.5) ABC-type multidrug transport system, ATPase component [676] TK0676 5e-10(57.8) ABC-type multidrug transport system, ATPase and permease components [436] TK0436 2e-06(45.8) ABC transporter ATPase

UniProt	O57758 : N-term changed (+27)
INSD	BAA29090.1 (DDBJ GenBank EMBL) : N-term changed (+27)
RefSeq	NP_142044.1 : N-term changed (+27)
GI	14589983 : N-term changed (+27)
GeneID	1443923 : N-term changed (+27)
UniParc	UPI00000667A4 : N-term changed (+27)

Computational search results

BLASTP
Database:UniProtKB:12.5

show BLAST table

1	E=0	O57758_PYRHO	373aa long hypothetical sugar-binding transport ATP-binding protein	Alignment
2	E=0	Q9V2Q1_PYRAB	MalK-1 ATP hydrolyzing subunit of the trehalose/maltose transport system	Alignment
3	E=0	Q8TZM0_PYRFU	Putative multiple sugar-binding transport ATP-binding protein	Alignment
4	E=1e-127	A3DLA5_STAMF	ABC transporter related	Alignment
5	E=1e-121	A2BJL9_HYPBU	Maltose/maltodextrin import ATP-binding protein	Alignment

HAMAP

No significant hit

InterPro
Database:interpro:16.0

IPR003439 ABC transporter related (Conserved_site)
	PS00211 ABC_TRANSPORTER_1
IPR003439 ABC transporter related (Domain)
	PS50893 ABC_TRANSPORTER_2
	PF00005 ABC_tran
	PD000006 Q8TZM0_PYRFU_Q8TZM0;
	PS00211 ABC_TRANSPORTER_1
IPR003593 AAA ATPase (Domain)
	SM00382 no description
IPR008995 Molybdate/tungstate binding (Domain)
	SSF50331 MOP-like
IPR012340 Nucleic acid-binding, OB-fold (Domain)
	G3DSA:2.40.50.140 no description
IPR013611 Transport-associated OB (Domain)
	PF08402 TOBE_2

SignalP

No significant hit

TMHMM

No significant hit

SOSUI

No significant hit

Calculated information (Amino acid sequence)

size of protein

364 amino acids

molecular mass

41,072.05 Da

6.9

aa composition

Ala	Val	Leu	Ile	Phe	Trp	Pro	Met	Gly	Ser
5.8 (21aa)	10.2 (37aa)	11 (40aa)	6.6 (24aa)	3.8 (14aa)	0.5 (2aa)	4.9 (18aa)	4.1 (15aa)	7.1 (26aa)	2.5 (9aa)
Thr	Cys	Asn	Gln	Tyr	Lys	His	Arg	Asp	Glu
5.8 (21aa)	0.3 (1aa)	3 (11aa)	3 (11aa)	2.5 (9aa)	7.1 (26aa)	1.9 (7aa)	6 (22aa)	6 (22aa)	7.7 (28aa)

Sequence

>PH0022.1 ABC transporter ATP binding protein
ATGGTTGAAGTTAAACTCGAAAATTTAACGAAAAGGTTCGGGAACTTTACGGCCGTTAAT
AAGCTTAACCTAACAATTAAGGATGGGGAATTTCTGGTTTTATTAGGGCCCAGCGGTTGC
GGTAAAACAACTACGTTGAGAATGATAGCTGGGTTGGAAGAACCGACGGAGGGGAGGATA
TACTTCGGTGATAGAGATGTCACGTATCTTCCACCTAAGGATAGGAATATAAGCATGGTG
TTCCAGAGCTATGCAGTATGGCCCCACATGACCGTTTATGAGAATATAGCTTTTCCTCTC
AAGATAAAGAAGTTTCCAAAGGATGAAATTGACAAGAGGGTTAGATGGGCCGCGGAGCTT
TTACAGATAGAGGAATTGTTGAATAGGTATCCAGCCCAGCTCTCTGGAGGTCAGAGGCAG
AGGGTTGCTGTAGCTAGAGCTATTGTAGTTGAGCCTGATGTTTTGCTAATGGATGAGCCA
TTGAGCAACTTAGACGCTAAGCTAAGGGTTGCTATGAGGGCCGAGATAAAGAAGTTGCAG
CAGAAGCTTAAGGTCACAACCATTTACGTTACCCATGATCAGGTTGAGGCCATGACGATG
GGTGATAGAATAGCCGTCATGAACAGGGGCCAACTACTTCAGATAGGATCGCCGACTGAA
GTTTACTTAAGGCCTAACTCAGTATTTGTGGCAACCTTCATAGGGGCCCCTGAGATGAAC
ATACTTGAGGTTTCAGTAGGGGATGGCTACTTGGAGGGTAGAGGATTCAGAATAGAGCTT
CCACAAGACTTAATGGATCTCCTGAAGGATTACGTAGGGAAAACGGTATTGTTCGGGATT
AGGCCTGAGCACATGACAGTTGAAGGCGTAAGTGAGCTAGCTCACATGAAGAGAACGGCC
AGACTTATTGGAAAGGTTGACTTCGTTGAAGCGTTGGGAACTGATACAATACTTCACGTG
AAGTTTGGGGATGAACTCGTGAAGGTTAAACTTCCTGGACACATTCCCATAGAGCCTGGT
AGAGAGGTCAAGGTGATCATGGACTTAGATATGATCCACGTGTTTGACAAAGATACTGAG
AAGGCGATAGTCTAG


>PH0022.1 ABC transporter ATP binding protein
MVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRI
YFGDRDVTYLPPKDRNISMVFQSYAVWPHMTVYENIAFPLKIKKFPKDEIDKRVRWAAEL
LQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQ
QKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMN
ILEVSVGDGYLEGRGFRIELPQDLMDLLKDYVGKTVLFGIRPEHMTVEGVSELAHMKRTA
RLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTE
KAIV

CDS Information : PH0022.1

Genomic map

Pyrococcus horikoshii OT3T (= NBRC 100139T) chromosome

Location

Annotation

Comparative genome

Related links to external database

Computational search results

Calculated information (Amino acid sequence)

Sequence

Pyrococcus horikoshii OT3^T (= NBRC 100139^T) chromosome