CDS Information : ROP_00140

Display	1000bp 10000bp 100000bp Clone

Rhodococcus opacus B4 chromosome	Legend Jump
Overview  Genome Proteome  Clone

Center position		change
ID		change
Gene name		change

Organism	Rhodococcus opacus B4
Replicon	chromosome
Start / Stop / Direction	13,097 / 12,666 / -
Location	complement(12666..13097)
Type	CDS
Length	432 bp (143 aa)

Product	putative MerR family transcriptional regulator
Gene name
Functional category	Genetic Information Processing - Transcription
EC number
Note	Belongs to the MerR transcriptional regulator family, which includes the mercuric resistance operon regulatory protein MerR of Bacillus subtilis (P22853), the redox-sensitive transcriptional activator SoxR of Escherichia coli (P0ACS2) and the HTH-type transcriptional activator TipA of Streptomyces lividans (P0A4T9).
KEGG pathway
Sequence feature
References	Family/Domain:merR_DBD Uniprot:P0A183 Pubmed:6091128,2538625 Uniprot:P13111 Pubmed:2666393

BLASTP Database:UniProtKB:14.0 show BLAST table	1 E=8e-47 Q6XN13_RHOER Putative MerR-family regulator Alignment 2 E=3e-45 Q5YM47_NOCFA Putative transcriptional regulator Alignment 3 E=1e-36 A1SIS0_NOCSJ Transcriptional regulator, MerR family Alignment 4 E=4e-25 A6X3R0_OCHA4 Putative transcriptional regulator, MerR family Alignment 5 E=3e-24 A6CV11_9VIBR Transcriptional regulator, MerR family protein Alignment
HAMAP	No significant hit
InterPro Database:interpro:18.0	IPR000551 Bacterial regulatory protein, MerR (Domain) SM00422   no description PF00376   MerR PS50937   HTH_MERR_2 PS00552   HTH_MERR_1 IPR009061 Putative DNA binding (Domain) SSF46955   Putative DNA-binding domain IPR015358 Transcription regulator MerR, DNA binding (Domain) PF09278   MerR-DNA-bind
SignalP	No significant hit
TMHMM	No significant hit
SOSUI	No significant hit

size of protein	143 amino acids
molecular mass	15,779.78 Da
pI	6.51
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 11.2 (16aa) 6.3 (9aa) 11.2 (16aa) 1.4 (2aa) 1.4 (2aa) 0 (0aa) 5.6 (8aa) 2.1 (3aa) 8.4 (12aa) 4.2 (6aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 5.6 (8aa) 2.8 (4aa) 2.1 (3aa) 3.5 (5aa) 3.5 (5aa) 2.1 (3aa) 2.8 (4aa) 11.2 (16aa) 7 (10aa) 7.7 (11aa)

>ROP_00140 putative MerR family transcriptional regulator
GTGGGGTACGGGGTTGAGAATGGCGGCATGCGTAGCAGTGAGGTCGCCGCCCGCACCGGG
GTGAATGTGCAGACGCTGCGGTACTACGAGCGCCGCGGCCTGTTGACGCCGCCGCCGCGG
TCGCCGGCCGGGTATCGGGCGTATCCGGCCGACGCCGTGGCGGTGGTCCGATTCGTCAAA
CGGGCTCAGGGGCACGGGTTCAGCCTCGACGAGATCGAGGACCTGTTGCATCTGGCCGAG
GGCGGACCGGATGACTGCAATACGGCGCGGGAACTCGCCGAGGCCAAGCTCGCTCAGCTG
GCCGAGAAGATCGCCGACCTGCAACGCATGCAGCGGTCCCTCTCCGATCTCGTCGCCACG
TGCGAGCGGCCACGCACCGACCGGTGCTGCCCGCTGCTGCACACCCTGCACACCGAAGGA
GATGACCGATGA


>ROP_00140 putative MerR family transcriptional regulator
MGYGVENGGMRSSEVAARTGVNVQTLRYYERRGLLTPPPRSPAGYRAYPADAVAVVRFVK
RAQGHGFSLDEIEDLLHLAEGGPDDCNTARELAEAKLAQLAEKIADLQRMQRSLSDLVAT
CERPRTDRCCPLLHTLHTEGDDR

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.