CDS Information : ROP_22560

Display	1000bp 10000bp 100000bp Clone

Rhodococcus opacus B4 chromosome	Legend Jump
Overview  Genome Proteome  Clone

Center position		change
ID		change
Gene name		change

Organism	Rhodococcus opacus B4
Replicon	chromosome
Start / Stop / Direction	2,413,531 / 2,413,881 / +
Location	2413531..2413881
Type	CDS
Length	351 bp (116 aa)

Product	hypothetical membrane protein
Gene name
Functional category	Unclassified - hypothetical protein
EC number
Note
KEGG pathway
Sequence feature
References

BLASTP Database:UniProtKB:14.0 show BLAST table	1 E=1e-16 Q2J7X3_FRASC Putative uncharacterized protein Alignment 2 E=3e-05 Q039V7_LACC3 Putative uncharacterized protein Alignment 3 E=4e-05 Q9X9S3_STRLI Putative uncharacterized protein ORF12 Alignment 4 E=6e-05 B1DM43_9BACL Putative uncharacterized protein Alignment 5 E=6e-05 A9VPL3_BACWK Putative uncharacterized protein Alignment
HAMAP	No significant hit
InterPro	No significant hit
SignalP	No significant hit
TMHMM	Transmembrane 3
SOSUI	Transmembrane 3

size of protein	116 amino acids
molecular mass	11,890.94 Da
pI	8.56
aa composition	Ala Val Leu Ile Phe Trp Pro Met Gly Ser 23.3 (27aa) 13.8 (16aa) 11.2 (13aa) 1.7 (2aa) 3.4 (4aa) 3.4 (4aa) 6 (7aa) 2.6 (3aa) 5.2 (6aa) 6.9 (8aa) Thr Cys Asn Gln Tyr Lys His Arg Asp Glu 6 (7aa) 0.9 (1aa) 1.7 (2aa) 2.6 (3aa) 0 (0aa) 0.9 (1aa) 1.7 (2aa) 4.3 (5aa) 1.7 (2aa) 2.6 (3aa)

>ROP_22560 hypothetical membrane protein
ATGAGCGAAGCCGACCCGCAACGAGTGGGTGCTCTCGACGTCGTGGCCTTCGCCTGTGAG
ATCGCGATGCTGGTCCTGCTCGCTGTCGCGGGGTGGTCGCTCGCGAACTCGACGGTCGTT
CAGGTGGTACTCGCGTCGCTCCTCCCGGTGGCAGCTGCCACGATCTGGGGTGTCGCCATG
GCACCGAAATCGAGCCGACGACTACCCAACCCCGCACGACTGGTCGCCCAGACCGCTCTG
TTCGCGGCGACCGGCGTACTCGTTGCATCCGCCGGTCACCCGTGGTGGGGGTTGGCCTTC
GCCGTCGTGGCGACGGCGACGTTCGCGGCTCGCTCACACACACCGGAGTAG


>ROP_22560 hypothetical membrane protein
MSEADPQRVGALDVVAFACEIAMLVLLAVAGWSLANSTVVQVVLASLLPVAAATIWGVAM
APKSSRRLPNPARLVAQTALFAATGVLVASAGHPWWGLAFAVVATATFAARSHTPE

NBRC No.	clone name	start	stop	length(bp)
G13-001-092	RO1FO01L80004L14	2,388,915	2,430,413	41,499

We have been distributing copies of the microbial genomic DNA clones constructed during the course of each of the genomic DNA sequencing projects.
You can find more detailed information at http://www.nbrc.nite.go.jp/e/mdna-e.html.