CDS Information : SA0602

open/close all

Genomic map

Display

Staphylococcus aureus N315 chromosome

Legend Jump

Overview
Genome

Center position		change
ID		change
Gene name		change

Genome	Display	Sync
chromosome

Location

Organism	Staphylococcus aureus N315
Replicon	chromosome
Start / Stop / Direction	697,357 / 698,154 / +
Location	697357..698154
Type	CDS
Length	798 bp (265 aa)

Annotation

Product	iron-hydroxamate transport ATP-binding protein
Gene name	fhuC
Functional category	Cell envelope and cellular processes - Transport / binding proteins and lipoproteins
EC number
Note
KEGG pathway
Sequence feature
References

Comparative genome

Table

Display	BBH1e-1001e-501e-101e-3

Staphylococcus epidermidis ATCC 12228	Staphylococcus epidermidis RP62A
[421] SE0421 7e-133(465) ferrichrome transport ATP-binding protein [517] SE0517 1e-51(195) ferrichrome ABC transporter ATP-binding protein [797] SE0797 6e-25(107) PotA protein [222] SE0222 1e-24(106) glycine betaine/carnitine/choline ABC transporter (ATP-bindin) opuCA [1243] SE1243 1e-24(106) ABC transporter ATP-binding protein [1067] SE1067 3e-24(104) phosphate ABC transporter [1540] SE1540 2e-23(102) glutamate ABC transporter ATP-binding protein [1795] SE1795 3e-23(101) cobalt transporter ATP-binding subunit(cbiO) [683] SE0683 4e-23(101) OppF protein [2255] SE2255 4e-23(100) transport system protein [429] SE0429 6e-23(100) ABC transporter ATP-binding protein [502] SE0502 8e-23(99.8) choline transport ATP-binding protein [2406] SE2406 3e-22(97.8) ABC transporter ATP-binding protein [600] SE0600 4e-22(97.8) ABC transporter ATP-binding protein [2018] SE2018 9e-22(96.3) glycine betaine/carnitine/choline ABC transporter (ATP-bindin) opuCA [2400] SE2400 2e-21(95.5) VraD protein [682] SE0682 2e-21(95.1) oligopeptide transport ATP-binding protein subunit [2322] SE2322 5e-21(94) ABC transporter ATP-binding protein [1991] SE1991 5e-21(94) ABC transporter (ATP binding subunit) [407] SE0407 6e-21(94) ABC transporter ATP-binding protein [1794] SE1794 7e-21(93.6) cobalt transporter ATP-binding subunit(cbiO) [2025] SE2025 3e-20(91.7) ABC transporter ATP-binding protein [1108] SE1108 3e-20(91.3) multiple sugar-binding transport ATP-binding protein [209] SE0209 2e-19(88.6) opp-1D protein [1121] SE1121 2e-18(85.1) ABC transporter ATP-binding protein [94] SE0094 3e-18(84.7) ABC transporter EcsA-like protein [117] SE0117 4e-17(81.3) ABC transporter ATP-binding protein [456] SE0456 5e-17(80.5) ABC transporter [1517] SE1517 6e-17(80.5) ABC transporter EcsA-like protein [2455] SE_p503 9e-17(79.7) ABC transporter [198] SE0198 2e-16(78.6) hypothetical protein [418] SE0418 2e-16(78.6) ATP-binding cassette transporter A [210] SE0210 6e-16(77.4) opp-1F protein [1061] SE1061 2e-15(75.5) oligopeptide transport ATPase [1648] SE1648 2e-15(75.5) vga protein [774] SE0774 4e-15(74.3) cation ABC transporter [2193] SE2193 4e-15(74.3) ABC transporter ATP-binding protein [1622] SE1622 1e-14(72.8) ABC transporter ATP-binding protein [1624] SE1624 7e-14(70.5) ABC transporter ATP-binding protein [1550] SE1550 7e-14(70.1) ABC transporter ATP-binding protein [212] SE0212 1e-13(69.7) ABC transporter protein [998] SE0998 7e-13(67) ABC transporter ATP-binding protein [1850] SE1850 2e-11(62) molybdenum transport ATP-binding protein ModC [1939] SE1939 1e-10(59.7) ABC transporter ATP-binding protein [1060] SE1060 1e-09(56.2) opp-2F protein [500] SE0500 2e-09(55.1) ABC transporter ATP-binding protein [1072] SE1072 4e-09(54.3) ABC transporter ATP-binding protein [606] SE0606 4e-09(54.3) ABC transporter ATP-binding protein [1082] SE1082 7e-09(53.5) ABC transporter protein [542] SE0542 4e-08(51.2) excinuclease ABC subunit A(uvrA) [455] SE0455 1e-07(49.7) hypothetical protein [2388] SE2388 3e-07(48.1) ABC transporter ATP-binding protein [411] SE0411 2e-06(45.1) teichoic acids export protein ATP-binding subunit [1555] SE1555 0.0002(38.9) teichoic acid translocation ATP-binding protein TagH	[301] SERP0306 7e-133(465) iron compound ABC transporter, ATP-binding protein [394] SERP0402 1e-51(195) iron compound ABC transporter, ATP-binding protein [668] SERP0686 1e-25(109) spermidine/putrescine ABC transporter, ATP-binding protein(potA) [2304] SERP2358 1e-24(106) amino acid ABC transporter, ATP-binding protein [1096] SERP1122 1e-24(105) ABC transporter, ATP-binding protein [933] SERP0957 3e-24(104) phosphate ABC transporter, ATP-binding protein [1361] SERP1394 2e-23(102) amino acid ABC transporter, ATP-binding protein, putative [1764] SERP1803 3e-23(101) cobalt transporter ATP-binding subunit(cbiO) [562] SERP0573 4e-23(101) oligopeptide ABC transporter, ATP-binding protein OppF(oppF) [2233] SERP2285 4e-23(100) phosphonate ABC transporter, ATP-binding protein [309] SERP0314 6e-23(100) ABC transporter, ATP-binding protein [378] SERP0385 7e-23(100) ABC transporter, ATP-binding protein [15] SERP0015 4e-22(97.8) ABC transporter, ATP-binding protein [479] SERP0489 4e-22(97.4) ABC transporter, ATP-binding protein [1985] SERP2031 9e-22(96.3) amino acid ABC transporter, ATP-binding protein [21] SERP0021 2e-21(95.1) ABC transporter, ATP-binding protein [561] SERP0572 2e-21(95.1) oligopeptide ABC transporter, ATP-binding protein OppD(oppD) [93] SERP0097 5e-21(94) ABC transporter, ATP-binding protein [1957] SERP2003 5e-21(94) amino acid ABC transporter, ATP-binding protein [287] SERP0292 6e-21(94) ABC transporter, ATP-binding protein(sitA) [1763] SERP1802 1e-20(92.8) cobalt transporter ATP-binding subunit(cbiO) [1992] SERP2038 3e-20(91.3) ABC transporter, ATP-binding protein [2315] SERP2369 2e-19(88.6) peptide ABC transporter, ATP-binding protein [2510] SEA0018 3e-19(88.2) ABC transporter, ATP-binding protein [979] SERP1004 3e-18(85.1) ABC transporter, ATP-binding protein [1339] SERP1372 3e-17(81.3) ABC transporter, ATP-binding protein [2324] SERP2378 2e-16(78.6) ABC transporter, ATP-binding protein [2314] SERP2368 2e-16(78.6) peptide ABC transporter, ATP-binding protein [298] SERP0303 2e-16(78.6) ABC transporter, ATP-binding/permease protein(abcA) [336] SERP0341 5e-16(77.4) ABC transporter ATP-binding protein [1621] SERP1658 2e-15(75.5) ABC transporter, ATP-binding protein [927] SERP0951 4e-15(74.3) peptide ABC transporter, ATP-binding protein, putative [644] SERP0661 4e-15(74.3) ABC transporter, ATP-binding protein [2158] SERP2204 4e-15(74.3) ABC transporter, ATP-binding protein [960] SERP0984 6e-15(73.6) ABC transporter, ATP-binding protein [1439] SERP1475 1e-14(72.4) ABC transporter, ATP-binding protein [1370] SERP1403 6e-14(70.5) ABC transporter, permease/ATP-binding protein [1441] SERP1477 7e-14(70.5) ABC transporter, ATP-binding protein [864] SERP0886 3e-13(68.6) ABC transporter, ATP-binding protein [1819] SERP1859 2e-11(62) molybdenum ABC transporter, ATP-binding protein ModC(modC) [1907] SERP1951 5e-11(60.8) ABC transporter, ATP-binding protein [376] SERP0383 2e-09(55.1) ABC transporter, ATP-binding protein [926] SERP0950 3e-09(54.7) peptide ABC transporter, ATP-binding protein, putative [938] SERP0962 4e-09(54.7) ABC transporter, ATP-binding protein [486] SERP0496 4e-09(54.3) FeS assembly ATPase SufC(sufC) [418] SERP0427 4e-08(51.2) excinuclease ABC subunit A(uvrA) [335] SERP0340 2e-07(49.3) ABC transporter ATP-binding protein [291] SERP0296 2e-06(45.1) teichoic acids export protein ATP-binding subunit [1376] SERP1409 0.0002(38.9) ABC transporter, ATP-binding protein

Staphylococcus epidermidis ATCC 12228

Staphylococcus epidermidis RP62A

[421] SE0421 7e-133(465)
ferrichrome transport ATP-binding protein

[301] SERP0306 7e-133(465)
iron compound ABC transporter, ATP-binding protein

UniProt	Q7A704
INSD	BAB41835.1 (DDBJ GenBank EMBL)
RefSeq	NP_373857.1
GI	15926324
GeneID	1123409
UniParc	UPI00000549B6

Computational search results

BLASTP
Database:UniProtKB:2010_04

show BLAST table

1	E=1e-153	Q7A704_STAAN	Iron-hydroxamate transport ATP-binding protein	Alignment
2	E=1e-153	Q7A2V8_STAAM	Ferrichrome transport ATP-binding protein	Alignment
3	E=1e-153	Q7A1M0_STAAW	Iron-hydroxamate transport ATP-binding protein	Alignment
4	E=1e-153	Q6GJ23_STAAR	Ferrichrome transport ATP-binding protein	Alignment
5	E=1e-153	Q6GBI3_STAAS	Ferrichrome transport ATP-binding protein	Alignment

HAMAP

No significant hit

InterPro
Database:interpro:25.0

IPR003439 ABC transporter related (Conserved_site)
	PS00211 ABC_TRANSPORTER_1
IPR003439 ABC transporter related (Domain)
	PS00211 ABC_TRANSPORTER_1
	PF00005 ABC_tran
	PS50893 ABC_TRANSPORTER_2
IPR003593 AAA ATPase (Domain)
	SM00382 no description

SignalP

No significant hit

TMHMM

No significant hit

SOSUI

No significant hit

Calculated information (Amino acid sequence)

size of protein

265 amino acids

molecular mass

29,495.87 Da

5.64

aa composition

Ala	Val	Leu	Ile	Phe	Trp	Pro	Met	Gly	Ser
5.3 (14aa)	6.8 (18aa)	10.6 (28aa)	9.4 (25aa)	2.6 (7aa)	0.8 (2aa)	3 (8aa)	1.9 (5aa)	7.9 (21aa)	4.5 (12aa)
Thr	Cys	Asn	Gln	Tyr	Lys	His	Arg	Asp	Glu
7.2 (19aa)	1.5 (4aa)	3.4 (9aa)	5.3 (14aa)	1.9 (5aa)	6.8 (18aa)	2.6 (7aa)	4.5 (12aa)	7.2 (19aa)	6.8 (18aa)

Sequence

>SA0602 iron-hydroxamate transport ATP-binding protein
ATGAATCGTTTGCATGGACAACAAGTTAAAATTGGTTACGGGGATAACACGATTATAAAT
AAATTAGATGTTGAAATACCAGATGGCAAAGTGACGTCAATCATTGGTCCTAACGGCTGC
GGGAAATCTACTTTGCTAAAGGCATTGTCACGTTTATTGGCAGTTAAAGAAGGCGAAGTA
TTTTTAGATGGTGAAAATATTCATACACAATCTACGAAAGAGATTGCAAAAAAAATAGCC
ATTTTACCTCAATCACCTGAAGTAGCAGATGGCTTAACTGTTGGGGAATTAGTTTCATAT
GGTCGTTTTCCACATCAAAAAGGATTTGGTAGATTAACTGCTGAGGATAAGAAAGAAATT
GATTGGGCAATGGAAGTTACAGGAACTGATACATTCCGACACCGTTCAATCAATGATTTA
AGTGGTGGTCAAAGACAACGTGTTTGGATTGCAATGGCATTAGCACAAAGAACTGATATT
ATCTTTTTAGACGAACCAACAACATATTTAGATATCTGTCATCAATTAGAAATACTAGAA
TTAGTTCAGAAGCTAAATCAGGAACAAGGTTGTACAATTGTCATGGTTCTTCATGATATC
AACCAAGCGATTCGTTTCTCAGATCATCTTATTGCGATGAAAGAAGGGGATATCATCGCT
ACAGGTTCAACAGAAGACGTATTAACACAGGAAATATTAGAAAAAGTTTTTAATATTGAT
GTTGTTTTAAGTAAAGATCCTAAAACTGGAAAACCTTTACTGGTAACTTATGACTTATGT
CGCAGAGCTTATTCTTAA


>SA0602 iron-hydroxamate transport ATP-binding protein
MNRLHGQQVKIGYGDNTIINKLDVEIPDGKVTSIIGPNGCGKSTLLKALSRLLAVKEGEV
FLDGENIHTQSTKEIAKKIAILPQSPEVADGLTVGELVSYGRFPHQKGFGRLTAEDKKEI
DWAMEVTGTDTFRHRSINDLSGGQRQRVWIAMALAQRTDIIFLDEPTTYLDICHQLEILE
LVQKLNQEQGCTIVMVLHDINQAIRFSDHLIAMKEGDIIATGSTEDVLTQEILEKVFNID
VVLSKDPKTGKPLLVTYDLCRRAYS

CDS Information : SA0602

Genomic map

Staphylococcus aureus N315 chromosome

Location

Annotation

Comparative genome

Related links to external database

Computational search results

Calculated information (Amino acid sequence)

Sequence