close all open/close all
first first   A4092_00020 A4092_00020

CDS information : A4092_00010


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction141 / 1 / - [in whole cluster]
141 / 1 / - [in contig]
Locationcomplement(1..141) [in whole cluster]
complement(1..141) [in contig]
TypeCDS
Length141 bp (46 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF1; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MGGSAELLPGDPARLGDYWLAGRLGSGGQGVVYEAYDEGGRRVAIKI
selected fasta
>[hypothetical protein]
ATGGGTGGTTCGGCCGAGCTGCTCCCGGGCGATCCGGCGCGCCTGGGCGACTACTGGCTG
GCGGGGCGGCTGGGGTCGGGCGGGCAGGGAGTGGTCTACGAGGCGTACGACGAGGGCGGG
CGGCGCGTCGCGATCAAGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000719 Protein kinase, catalytic domain (Domain)
 [18-47]  PS50011
PS50011   PROTEIN_KINASE_DOM
IPR011009 Protein kinase-like domain (Domain)
 [13-47]  5.39999977351167e-07 SSF56112
SSF56112   Kinase_like
SignalP No significant hit
TMHMM No significant hit
first first   A4092_00020 A4092_00020