close all open/close all

CDS information : A4092_00020


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction1,207 / 347 / - [in whole cluster]
1,207 / 347 / - [in contig]
Locationcomplement(347..1207) [in whole cluster]
complement(347..1207) [in contig]
TypeCDS
Length861 bp (286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF2; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MTRHTTVQIQGLPVFYREAGDPANPTLVLLHGFPSSSAMFRNLIADLADSYHLIAPDHVG
FGQSAAPSVEEFPYSFDKLTEITLELLDTLNIDRFALYIHDYGAPIGLRIASRHPERVSA
IITQSGNAYLDGFTPFWEVLFAHAKDRATHEPAVRELLTADATRWQYTHGVPADLLERVS
PDSWVLDQAYLDRPGNKEVQLQLFWDYQFNLDGYPAFQEYFRTHRPPVLVAWGANDEIFG
AAGAEAYARDLPDAEIHLLDAGHFALETHGREIAGLIRDFLRRRLP
selected fasta
>[hypothetical protein]
ATGACTCGCCACACCACGGTTCAGATCCAGGGCCTGCCCGTCTTCTACCGGGAGGCGGGA
GACCCGGCCAACCCCACGCTGGTGCTGCTGCACGGCTTCCCCAGCAGCTCCGCCATGTTC
CGGAACCTGATCGCCGACCTGGCCGACTCCTACCATCTGATCGCCCCCGACCACGTCGGC
TTCGGCCAGTCGGCCGCGCCGTCGGTGGAGGAGTTCCCCTACAGCTTCGACAAGCTCACC
GAGATCACCCTCGAACTGCTCGACACGCTGAACATCGACCGGTTCGCCCTCTACATCCAC
GACTACGGCGCCCCCATCGGGCTGCGCATCGCCAGTCGCCACCCCGAGCGGGTGAGCGCG
ATCATCACCCAGAGCGGCAACGCCTATCTGGACGGCTTCACACCGTTCTGGGAGGTGCTG
TTCGCCCACGCCAAGGACCGCGCCACCCACGAGCCGGCGGTACGCGAGCTGCTGACCGCC
GACGCCACCCGGTGGCAGTACACCCACGGTGTGCCCGCAGACCTGCTGGAGCGCGTCAGC
CCGGACTCGTGGGTGCTCGACCAGGCCTACCTGGACCGGCCCGGCAACAAGGAGGTCCAG
CTCCAGCTCTTCTGGGACTACCAGTTCAACCTCGACGGCTACCCGGCCTTCCAGGAGTAC
TTCCGCACGCACCGCCCGCCCGTGCTGGTCGCCTGGGGTGCCAACGACGAGATCTTCGGG
GCCGCGGGCGCCGAGGCGTACGCCCGCGACCTGCCCGACGCCGAGATCCATCTCCTCGAC
GCCGGGCACTTCGCGCTGGAGACGCACGGCCGCGAGATCGCCGGGCTGATCCGCGACTTC
CTCCGCCGCAGGCTCCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [50-65]  9.00000407957274e-05 PR00111 [111-124]  9.00000407957274e-05 PR00111
PR00111   ABHYDROLASE
IPR000639 Epoxide hydrolase-like (Family)
 [31-49]  1.10000029896148e-06 PR00412 [97-110]  1.10000029896148e-06 PR00412 [111-124]  1.10000029896148e-06 PR00412 [258-280]  1.10000029896148e-06 PR00412
PR00412   EPOXHYDRLASE
SignalP No significant hit
TMHMM No significant hit