close all open/close all

CDS information : A4092_00030


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction2,627 / 1,797 / - [in whole cluster]
2,627 / 1,797 / - [in contig]
Locationcomplement(1797..2627) [in whole cluster]
complement(1797..2627) [in contig]
TypeCDS
Length831 bp (276 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF3; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MSRQDELREFLRSRRSRVAPRDVGLPARAGGRRVRGLRREELALAAGVSADYYTRMEQGR
AGNVSDQVLEAVAGVLRLTAEEQRHLRELIGDRHHARPRPPARPRAALRMMLDMLGPAPA
LLMTGVLDILALNRMGAALLTDFEAMPRPERNEIRWIFLDPRARDVFPDWEEVAVEAAAW
LRGALGRSGDDPRPQQLVDELSARSADFARHWADHRVTYCTYGTKRLRHPEVGVMTLNWE
SFAPTADPDLYLVVYTAPTGSPSEERLAALAGGQVS
selected fasta
>[hypothetical protein]
ATGAGCCGGCAGGACGAGCTGCGCGAGTTCCTGCGGTCGCGGCGGTCCCGGGTGGCCCCA
CGCGACGTGGGCCTGCCCGCGCGGGCCGGCGGCCGCCGGGTGCGCGGGCTGCGCCGCGAG
GAGCTGGCCCTGGCGGCCGGGGTCAGCGCCGACTACTACACCCGGATGGAGCAGGGCCGG
GCCGGCAACGTGTCCGACCAGGTGCTGGAGGCGGTCGCGGGCGTCCTGCGGCTCACCGCC
GAGGAGCAGCGCCACCTGCGCGAGCTGATCGGCGACCGGCATCACGCGCGCCCGCGCCCA
CCGGCACGCCCGCGCGCCGCGCTGCGCATGATGCTCGACATGCTCGGCCCGGCCCCCGCG
CTGCTGATGACCGGGGTCCTGGACATCCTGGCGCTCAACCGCATGGGGGCGGCCCTCCTG
ACCGACTTCGAGGCCATGCCGCGTCCCGAGCGCAACGAGATCCGCTGGATCTTCCTCGAC
CCGCGGGCCCGCGACGTCTTCCCCGACTGGGAGGAGGTCGCCGTGGAGGCCGCCGCCTGG
CTGCGGGGCGCGCTGGGCCGGTCCGGCGACGACCCGCGCCCCCAGCAGCTGGTCGACGAG
CTGAGCGCGCGTTCCGCCGACTTCGCCCGTCACTGGGCCGATCACCGAGTGACCTACTGC
ACGTACGGGACGAAGCGGCTGCGCCATCCGGAGGTGGGGGTCATGACGCTCAACTGGGAG
TCGTTCGCGCCCACCGCCGATCCAGACCTGTATCTCGTCGTCTACACCGCGCCGACCGGC
TCCCCGTCCGAGGAGAGGCTCGCGGCGCTGGCGGGCGGGCAGGTGAGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001387 Helix-turn-helix type 3 (Domain)
 [6-83]  1.29999924468179e-09 SM00530
SM00530   HTH_XRE
 [32-83]  PS50943
PS50943   HTH_CROC1
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [14-82]  1.8e-12 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
 [32-96]  5.30000239467942e-06 SSF47413
SSF47413   Lambda_like_DNA
SignalP No significant hit
TMHMM No significant hit