close all open/close all

CDS information : A4092_00040


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction4,181 / 3,225 / - [in whole cluster]
4,181 / 3,225 / - [in contig]
Locationcomplement(3225..4181) [in whole cluster]
complement(3225..4181) [in contig]
TypeCDS
Length957 bp (318 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF4; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MNIEDLLRETLSEMADEERPPAPSRFLQGRSLQAREHRPRRRGLALMAAAGVVALAVGAT
FVVRGLSPGTSGEAAGQPDAVASVVPEQRPAITVIVPPGMRLAQLLKRLSSVTGRPVAEF
ERAARDGAALGLPPYAKGRLEGFAAPGSYEISPAMSPGEILGAMVTGFGRLAEETGLVAG
AGRAGRTPLEILTIASIVQAESFRPEDMPKIARVLHNRLDRKMRLQVDSTVLYGLGKYGS
AATPEDVRSPSPYNTYRRPGLPPGPIGSPGADAVRAALEPAAGRWLYYVATDPRTGAMKF
ATTQTEYAALVEERDRNQ
selected fasta
>[hypothetical protein]
ATGAACATCGAGGACCTGCTGCGCGAGACCCTCTCCGAGATGGCCGACGAGGAGCGGCCA
CCGGCGCCGAGCCGGTTCCTCCAGGGCCGGTCCCTCCAGGCACGCGAGCACCGGCCCAGG
CGTCGCGGCCTCGCCCTGATGGCGGCGGCCGGGGTGGTCGCGCTGGCCGTCGGAGCCACG
TTCGTGGTGCGAGGGTTGTCGCCGGGCACCTCCGGTGAGGCCGCCGGGCAGCCGGACGCC
GTCGCGAGCGTGGTGCCCGAGCAGCGGCCGGCCATCACCGTGATCGTGCCACCGGGGATG
CGGCTCGCGCAGCTCCTCAAGAGGTTGTCGTCCGTGACCGGCAGGCCGGTGGCGGAGTTC
GAGCGAGCCGCCAGGGACGGCGCGGCACTCGGCCTGCCGCCGTACGCGAAGGGGAGGCTC
GAAGGGTTCGCCGCCCCCGGCAGCTACGAGATCTCCCCCGCCATGAGCCCCGGCGAGATC
CTCGGGGCGATGGTGACCGGTTTCGGGCGCCTCGCCGAGGAGACCGGCCTGGTGGCGGGC
GCCGGCCGGGCGGGCAGGACGCCGCTGGAGATCCTCACCATCGCCAGCATCGTCCAGGCC
GAGTCCTTCCGGCCGGAGGACATGCCGAAGATCGCCAGGGTCCTGCACAACCGGCTGGAT
CGGAAGATGCGGCTGCAGGTGGACAGCACGGTCCTGTACGGCCTGGGCAAGTACGGCTCC
GCCGCGACCCCCGAGGACGTCAGGAGCCCGTCGCCCTACAACACCTACCGGCGTCCCGGG
CTGCCGCCCGGCCCCATCGGCAGCCCGGGGGCCGACGCCGTCCGCGCGGCGCTGGAGCCG
GCCGCCGGTCGCTGGCTCTACTACGTGGCGACCGACCCGAGGACGGGCGCCATGAAGTTC
GCCACCACCCAGACGGAGTACGCCGCACTGGTCGAGGAGCGCGACAGGAACCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003770 Uncharacterised protein family UPF0755, YceG-like (Family)
 [79-312]  2.99999999999998e-57 PF02618
PF02618   YceG
 [140-308]  1.2e-31 TIGR00247
TIGR00247   TIGR00247
SignalP No significant hit
TMHMM
 [43-65]  Transmembrane (i-o)
Transmembrane 1