close all open/close all

CDS information : A4092_00050


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction4,690 / 4,178 / - [in whole cluster]
4,690 / 4,178 / - [in contig]
Locationcomplement(4178..4690) [in whole cluster]
complement(4178..4690) [in contig]
TypeCDS
Length513 bp (170 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF5; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MDPGFEAAFRDFVVGRSGALFRTAYLLTGERHAAEDLVQSALAKTAAKWRGLRDPAAIEG
YVRRVMYHEQVSWWRRRSRVAEVSTGWLPDQARDGHADGADLRVMMRAALGRLTPRQRTI
LVLRYFEDLSETEIARVLGIRVGSVRSQIHRSLERLKQTAPELTIMREFG
selected fasta
>[hypothetical protein]
GTGGATCCAGGATTCGAGGCGGCCTTCCGGGACTTCGTCGTCGGCCGGTCGGGGGCGTTG
TTCCGCACGGCGTACCTGCTGACCGGTGAGCGGCACGCCGCCGAGGACCTGGTGCAGTCG
GCCCTGGCCAAGACGGCCGCGAAGTGGCGCGGTCTGCGCGATCCCGCCGCCATCGAGGGG
TACGTGCGCCGGGTCATGTACCACGAGCAGGTGAGCTGGTGGCGGCGGCGGTCACGGGTC
GCGGAGGTGTCCACCGGGTGGCTGCCCGACCAGGCCCGTGACGGGCACGCCGACGGCGCG
GACCTGCGGGTGATGATGCGCGCGGCCCTCGGCCGGCTCACGCCCAGGCAGCGGACCATT
CTGGTGCTGCGCTACTTCGAGGACCTGTCGGAGACCGAGATCGCGCGGGTGCTCGGCATC
AGGGTGGGATCGGTACGCAGCCAGATCCACCGCTCGCTGGAACGCCTGAAGCAGACGGCG
CCTGAACTGACCATCATGAGGGAGTTCGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007627 RNA polymerase sigma-70 region 2 (Domain)
 [19-79]  7.59999999999999e-07 PF04542
PF04542   Sigma70_r2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [113-169]  1.2e-12 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR013249 RNA polymerase sigma factor 70, region 4 type 2 (Domain)
 [104-156]  1.5e-17 PF08281
PF08281   Sigma70_r4_2
IPR013324 RNA polymerase sigma factor, region 3/4 (Domain)
 [97-169]  3.80000697093586e-18 SSF88659
SSF88659   Sigma_r3_r4
IPR013325 RNA polymerase sigma factor, region 2 (Domain)
 [1-75]  1.20000117458134e-15 SSF88946
SSF88946   Sigma_r2
IPR014284 RNA polymerase sigma-70 (Domain)
 [8-158]  1.4e-21 TIGR02937
TIGR02937   Sigma70-ECF
IPR014325 RNA polymerase sigma-E type, actinobacteria (Family)
 [6-162]  5.79999999999997e-55 TIGR02983
TIGR02983   SigE-fam_strep
SignalP No significant hit
TMHMM No significant hit