close all open/close all

CDS information : A4092_00060


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction4,838 / 6,202 / + [in whole cluster]
4,838 / 6,202 / + [in contig]
Location4838..6202 [in whole cluster]
4838..6202 [in contig]
TypeCDS
Length1,365 bp (454 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF6; outside dalbavancin cluster

close this sectionSequence

selected fasta
>[hypothetical protein]
MAMDRRIFGLENEYGITCTFKGQRRLSPDEVARYLFRKVVSWGRSSNVFLGNGARLYLDV
GSHPEYATPECDNVVELVTHDKAGERIVEGLAVDAERRLREEGIAGDIYLFKNNTDSAGN
SYGCHENYCVGRHGEFGRLADVLIPFLVTRQVVCGAGKVLQTPRGAVYCLSQRAEHIWEG
VSSATTRSRPIINTRDEPHGDAERFRRLHVIVGDSNMSETTTLLKIGATDLVLRMIEAGV
VMRDLSLENPIRAIREVSHDMTGRRKVRLANGREASALEIQQEYLSKAADFVDRRGGDAT
ALRVLELWERTLRAVETGDLDLVSREIDWVTKYQMIERYRSKYDLPLSSSRVAQLDLAYH
DVHRRRGLFYLLQRKGLVERVASDVKIFEAKSVPPQTTRARLRGEFIRKAQEKRRDFTVD
WVHLKLNDQAQRTVLCKDPFRSVDERVDRLIAGM
selected fasta
>[hypothetical protein]
GTGGCGATGGACCGTCGCATCTTTGGCCTGGAGAACGAGTACGGGATCACCTGCACGTTC
AAAGGGCAGCGCAGGCTCTCTCCCGACGAAGTGGCACGCTACCTCTTCCGGAAGGTGGTG
TCCTGGGGCAGATCCAGCAACGTCTTCCTCGGCAACGGCGCGCGCCTGTACCTGGACGTG
GGCAGTCACCCGGAGTACGCCACTCCCGAGTGCGACAACGTCGTGGAGCTGGTGACGCAC
GACAAGGCCGGCGAACGCATCGTGGAAGGGCTGGCCGTGGACGCCGAGAGGCGGCTGCGC
GAGGAGGGCATCGCCGGGGACATCTACCTGTTCAAGAACAACACCGACTCGGCAGGCAAC
TCCTACGGCTGCCACGAGAACTACTGTGTGGGCCGGCACGGCGAGTTCGGCCGGCTGGCC
GACGTGCTGATCCCGTTCCTGGTGACCAGGCAGGTCGTGTGCGGGGCAGGGAAGGTCCTG
CAGACGCCGCGTGGCGCCGTCTACTGCCTGTCCCAGCGGGCCGAGCACATCTGGGAGGGC
GTCTCCAGCGCCACCACGCGCAGCCGTCCCATCATCAACACCCGCGACGAGCCGCACGGC
GACGCGGAGCGCTTCCGCCGGCTGCACGTGATCGTCGGCGACTCCAACATGAGCGAGACC
ACCACGCTGCTCAAGATCGGCGCCACTGACCTGGTGCTGCGCATGATCGAGGCCGGCGTC
GTGATGCGCGACCTGTCGCTGGAGAACCCGATCAGGGCCATCCGCGAGGTCTCCCACGAC
ATGACGGGCCGCCGCAAGGTCCGGCTGGCCAACGGGCGGGAGGCGTCCGCGCTGGAGATC
CAGCAGGAGTACCTGTCCAAGGCCGCGGACTTCGTCGATCGCCGCGGCGGCGACGCCACG
GCGCTCCGGGTGCTGGAGCTGTGGGAACGCACGCTGCGCGCGGTCGAGACGGGAGATCTC
GACCTGGTGTCCCGGGAGATCGACTGGGTGACGAAGTACCAGATGATCGAGCGTTATCGC
AGCAAGTACGACCTGCCGTTGTCCTCGTCGCGGGTGGCCCAGCTCGACCTGGCCTACCAC
GACGTGCATCGCCGGCGGGGGCTGTTCTACCTGTTGCAGCGCAAGGGCCTGGTGGAGCGG
GTCGCGTCCGATGTGAAGATCTTCGAGGCCAAGTCGGTGCCGCCGCAGACCACGCGGGCG
CGGCTGCGCGGCGAGTTCATCCGCAAGGCCCAGGAGAAGCGGCGCGACTTCACGGTCGAC
TGGGTGCATCTCAAGCTCAACGACCAGGCTCAGCGCACGGTGTTGTGCAAGGATCCGTTC
CGCTCGGTCGATGAGAGGGTCGACAGACTGATCGCCGGCATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004347 Pup ligase/deamidase (Family)
 [5-426]  PF03136
PF03136   Pup_ligase
 [1-454]  PIRSF018077
PIRSF018077   UCP018077
IPR022279 Pup ligase (Family)
 [5-454]  TIGR03686
TIGR03686   Pupylate_PafA
SignalP No significant hit
TMHMM No significant hit