close all open/close all

CDS information : A4092_00070


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction7,342 / 6,242 / - [in whole cluster]
7,342 / 6,242 / - [in contig]
Locationcomplement(6242..7342) [in whole cluster]
complement(6242..7342) [in contig]
TypeCDS
Length1,101 bp (366 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate oxidase
Product (GenBank)putative hydroxymandelate oxidase
Genedbv1
hmo
Gene (GenBank)dbv1
EC number1.1.3.46
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
O52792
NITE
Chlor_00230
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[12240298] Characterisation of a hydroxymandelate oxidase involved in the biosynthesis of two unusual amino acids occurring in the vancomycin group of antibiotics. (Chem Commun (Camb). , 2001)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate oxidase [putative hydroxymandelate oxidase]
MHESPVCLAEYEEIAAKVLPADVRDFIDGGSGREQTLRANRAAFDRVFLVPRVLQDVSAC
STRATLLGHPATMPVAVAPVAYHRLVHPDGELATARAARDAGVPFTVSTLSSVPVEDVTA
LGGHVWFQLYCLREHAATLGLIRRAEDAGCRALMLTLDVPWMGRRPRDIRNRFRLPPHVR
PVHLTANSGTEAHRGASGGSALAAHTAMELSAAVDWSYLETLRAASGLPLVVKGILHPED
ARRAADLGIDGIVVSNHGGRQLDGAVASLDALPGVAESVGGRCEIMLDGGVRSGADVLKA
LALGASGVLVGRPVIWGLAADGERGVRTVLGLLGAEIEDGLGLAGCGDVAAAQALRTTRP
GAGFVS
selected fasta
>putative 4-hydroxymandelate oxidase [putative hydroxymandelate oxidase]
GTGCACGAAAGTCCCGTCTGCCTCGCCGAGTACGAGGAGATCGCCGCCAAGGTCCTCCCC
GCCGACGTCCGGGACTTCATCGACGGCGGGAGCGGCCGCGAGCAGACCCTCCGTGCGAAT
CGGGCCGCCTTCGACCGGGTGTTCCTGGTGCCGCGGGTGCTCCAGGACGTGTCGGCGTGC
TCCACCCGTGCGACGCTGCTGGGCCACCCCGCGACGATGCCGGTGGCGGTGGCCCCCGTC
GCCTACCACCGGCTCGTGCATCCCGACGGTGAGCTGGCGACGGCCCGGGCGGCGCGGGAC
GCCGGGGTCCCGTTCACCGTCAGCACCTTGAGCAGCGTCCCGGTGGAGGACGTCACCGCC
CTGGGGGGACACGTCTGGTTCCAGCTCTACTGCCTTCGCGAGCACGCCGCCACCCTCGGC
CTGATCCGCCGGGCCGAGGACGCGGGGTGCCGGGCGTTGATGCTCACGCTCGATGTGCCG
TGGATGGGCCGCAGGCCACGTGACATCCGCAACCGGTTCCGCCTGCCCCCGCACGTGCGG
CCCGTGCACCTGACGGCGAACTCCGGGACCGAGGCTCATCGGGGTGCCTCCGGCGGCTCC
GCGCTGGCGGCGCACACGGCCATGGAGCTCTCCGCCGCGGTGGACTGGTCGTACCTCGAG
ACCCTCCGGGCCGCCAGCGGGCTCCCGCTGGTGGTCAAGGGCATTCTGCACCCCGAGGAC
GCCCGCCGCGCCGCGGACCTCGGCATCGACGGCATCGTGGTCTCCAACCACGGCGGACGT
CAGCTCGACGGCGCCGTGGCCAGTCTCGACGCGCTGCCGGGGGTGGCGGAGAGCGTCGGG
GGCCGCTGCGAGATCATGCTCGATGGTGGCGTCCGGTCGGGAGCCGACGTCCTCAAGGCG
CTGGCGCTCGGGGCGTCGGGTGTGCTCGTCGGACGCCCCGTGATCTGGGGTCTGGCCGCG
GACGGCGAACGGGGGGTCCGTACGGTGCTCGGCCTCCTGGGTGCCGAGATCGAGGACGGG
CTCGGCCTGGCAGGCTGCGGCGACGTCGCCGCAGCCCAGGCACTCAGGACGACCCGCCCC
GGCGCGGGGTTCGTCTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000262 FMN-dependent dehydrogenase (Domain)
 [15-353]  2.50000000000001e-128 PF01070
PF01070   FMN_dh
IPR008259 FMN-dependent alpha-hydroxy acid dehydrogenase, active site (Active_site)
 [255-261]  PS00557
PS00557   FMN_HYDROXY_ACID_DH_1
IPR012133 Alpha-hydroxy acid dehydrogenase, FMN-dependent (Family)
 [1-360]  PIRSF000138
PIRSF000138   Al-hdrx_acd_dh
 [1-362]  PS51349
PS51349   FMN_HYDROXY_ACID_DH_2
IPR013785 Aldolase-type TIM barrel (Domain)
 [6-352]  1.20000000000001e-130 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit