close all open/close all

CDS information : A4092_00080


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction8,531 / 7,461 / - [in whole cluster]
8,531 / 7,461 / - [in contig]
Locationcomplement(7461..8531) [in whole cluster]
complement(7461..8531) [in contig]
TypeCDS
Length1,071 bp (356 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative 4-hydroxymandelate synthase
Product (GenBank)putative hydroxymandelate synthase
Genedbv2
hmaS
Gene (GenBank)dbv2
EC number1.13.11.46
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
O52791
NITE
Chlor_00220
PmId
[11137816] Biosynthesis of L-p-hydroxyphenylglycine, a non-proteinogenic amino acid constituent of peptide antibiotics. (Chem Biol. , 2000)
[18215022] Two roads diverged: the structure of hydroxymandelate synthase from Amycolatopsis orientalis in complex with 4-hydroxymandelate. (Biochemistry. , 2008)

close this sectionSequence

selected fasta
>putative 4-hydroxymandelate synthase [putative hydroxymandelate synthase]
MESLPPLAVDYVEMYVADLKVATLPWTDEYRFAVVGTANASDHRSVALRQGRITLVLTQA
TSDGHPASAYVRTHGDGVADIALRTPDVDVVFTHAVAAGARPVRSPSRHPGPGPACSAAI
GGFGDVVHTLVQRDPGDDPGLPVGFSEAPSAAESGADAAELLDIDHFAVCLPTGDLDIIT
DFYVATLGFSETFKERIEVGTQAMESKVVQSASGAVTLTLIEPDPMAEAGQIDMFLERHA
GAGVQHVAFSSSDAVHAVNTLSERGVRFLSTPGSYYDLLESRIQIRGHTVDQLRATGLLA
DEDHGGQLFQIFTASTHPRETLFFEVIERQGARTFGGANIKALYEAVEVARSQQRA
selected fasta
>putative 4-hydroxymandelate synthase [putative hydroxymandelate synthase]
ATGGAATCGCTTCCGCCTCTCGCCGTTGATTACGTCGAAATGTACGTAGCGGATCTGAAG
GTCGCCACTCTCCCTTGGACCGACGAATACCGCTTCGCCGTCGTGGGCACGGCGAACGCC
AGCGACCATCGCAGCGTCGCGCTCCGGCAGGGCCGCATCACCCTCGTCCTCACCCAGGCC
ACGTCCGACGGCCATCCGGCTTCGGCCTATGTGCGGACGCACGGCGACGGGGTCGCCGAC
ATCGCCCTGCGGACCCCCGACGTCGACGTCGTCTTCACCCATGCCGTGGCCGCCGGCGCC
CGGCCCGTACGGTCCCCGTCCCGGCACCCCGGCCCCGGGCCGGCCTGCTCCGCCGCGATC
GGCGGCTTCGGCGACGTGGTCCACACCCTCGTCCAGCGGGACCCCGGCGACGACCCCGGC
CTGCCGGTCGGCTTCTCCGAGGCTCCGTCCGCCGCCGAGTCCGGTGCGGACGCGGCGGAG
CTGCTCGACATCGACCACTTCGCCGTGTGCCTGCCCACGGGTGACCTCGACATCATCACC
GACTTCTACGTCGCCACCCTCGGCTTCAGCGAGACCTTCAAGGAACGCATCGAGGTCGGC
ACCCAGGCCATGGAGTCCAAGGTGGTGCAGAGCGCCTCCGGCGCCGTCACGCTGACACTC
ATCGAACCCGACCCGATGGCCGAGGCCGGCCAGATCGACATGTTCCTCGAACGGCACGCC
GGTGCCGGGGTGCAGCACGTCGCCTTCTCCTCCTCGGACGCCGTGCACGCCGTGAACACC
CTGTCCGAGCGGGGCGTCCGCTTCCTCAGCACGCCGGGCAGCTACTACGACCTGCTCGAA
TCACGGATCCAGATCCGGGGTCACACGGTGGACCAGTTGCGCGCGACGGGACTGCTCGCT
GACGAGGATCACGGCGGACAGCTCTTCCAGATCTTCACGGCGTCCACCCATCCGCGCGAG
ACCCTCTTCTTCGAGGTCATCGAGCGGCAGGGAGCCCGCACCTTCGGAGGCGCCAACATC
AAGGCCCTCTACGAGGCCGTCGAGGTGGCGAGGTCCCAGCAGCGTGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain (Domain)
 [164-311]  6.50000000000001e-16 PF00903
PF00903   Glyoxalase
IPR005956 4-hydroxyphenylpyruvate dioxygenase (Family)
 [9-354]  9.49999999999983e-105 TIGR01263
TIGR01263   4HPPD
 [1-355]  1.29998211665775e-130 PIRSF009283
PIRSF009283   HPP_dOase
SignalP No significant hit
TMHMM No significant hit