close all open/close all

CDS information : A4092_00090


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction11,363 / 8,760 / - [in whole cluster]
11,363 / 8,760 / - [in contig]
Locationcomplement(8760..11363) [in whole cluster]
complement(8760..11363) [in contig]
TypeCDS
Length2,604 bp (867 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductLuxR family transcriptional activator
Product (GenBank)putative regulator LuxR family
Gene
Gene (GenBank)dbv3
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionSequence

selected fasta
>LuxR family transcriptional activator [putative regulator LuxR family]
MLFGRDRELKSLTRLLDSTAAGRGGVAVITGPVVGGKTAILHELGMRSIAAGIRLVTARC
TPAEQSLDWGVADQILGRGAAERLTARRGGDAVEDVCVSLFQMAEANPILLTIDDVDLAD
DPSLLAILSMTPLLTDTRMMIAVTICQDRPPAPLPHVAESLLRLPGIELVELPLLPRPAV
RQFATEHLGAETADQLADDLYRFSGGSPLLVRALIEDQEAGAPGLVVGDSFMSAVAACVH
GCEPEAVRVAEAVAVLGEHATPDAVGELVGIAPPAATRSMGMLERAGLLAGGRFRHEAGR
LAVLGRMTSYGRMEILRRAAEILHRRGGPPSAVATRLLEAGWSGEEWAFDVLVEAGRQAF
DEGDFVAVMKCLRLALASGWGTPRRLDVKVMLAAAEWRVDPAVAARHVPDLLDATRSGAL
RGSHGMELFRQLLWYGRFADAAELIDRLRPSVADRDADASLIAMCHVHPVLLDRLPRSAR
GSMGQTVEDARRILRQAEPTDEAMDSIISALMALLLGGVSEVAASCETLLKEPGVTKAPT
WKAIISAIRAETAWRKGDLAGAEAHAQEALTILQPSGWGVAIGAPLSTLLHAQTAMGHLD
EAKATVAVPMPRETAETAFGIGYELARAHYHLVTEQPRAAFAGFLACGQAVQRWGSSLSD
VVPWRLGAARACLQLGWRRRAADLVTAQIAHTSSGDLRTYGVALRLHAQLSKPAQRQRLL
MQSVDALEAAQDRYQLALSLCDLAGTPQLKGGKDEARAYWVRAQELARECNAKPLMRRLA
AQHDHGETAPLSGAERRVAVLAARGHTNREIAEALYITRSTVEQHLTRIYRKLHVQTRGD
LGNLFAADIADKATATAGREPREAVRL
selected fasta
>LuxR family transcriptional activator [putative regulator LuxR family]
GTGCTGTTCGGGCGAGATCGTGAACTGAAGAGTCTGACGAGGTTGCTCGATTCCACCGCG
GCCGGCCGCGGTGGAGTGGCCGTCATCACGGGGCCTGTGGTCGGCGGCAAGACCGCCATC
CTCCACGAGCTCGGCATGCGATCCATCGCGGCCGGCATCCGGCTGGTCACGGCCCGCTGC
ACGCCGGCGGAGCAGTCGCTGGACTGGGGGGTCGCCGACCAGATCCTGGGCCGCGGGGCA
GCGGAGCGGCTGACCGCGCGCAGGGGCGGTGACGCGGTCGAGGACGTCTGCGTCTCCCTG
TTCCAGATGGCCGAGGCGAACCCGATCCTCCTGACGATCGACGACGTGGATCTCGCCGAC
GATCCGTCCCTGCTGGCCATCCTGTCCATGACGCCCCTGCTGACGGACACCAGGATGATG
ATCGCCGTCACGATCTGCCAGGACCGGCCGCCGGCCCCTCTCCCCCATGTCGCCGAGTCC
TTGCTGCGCCTGCCCGGCATCGAGCTGGTCGAGCTGCCGCTCCTGCCCCGTCCGGCGGTC
AGGCAGTTCGCCACCGAGCACCTCGGGGCCGAGACGGCCGACCAGCTCGCCGACGACCTC
TACCGCTTCAGCGGCGGCAGCCCGCTGCTGGTCCGGGCGCTGATCGAGGATCAGGAGGCC
GGCGCGCCCGGGCTCGTGGTCGGCGACTCCTTCATGAGCGCGGTGGCAGCGTGCGTTCAT
GGCTGCGAGCCGGAGGCCGTCCGCGTCGCGGAGGCGGTGGCCGTCCTCGGCGAGCACGCC
ACGCCGGACGCGGTGGGCGAGCTCGTGGGCATCGCCCCTCCTGCCGCGACACGCTCGATG
GGGATGCTGGAGCGCGCCGGGCTCCTGGCCGGGGGGCGCTTTCGTCATGAGGCGGGCCGC
CTGGCCGTACTCGGGCGCATGACCTCCTACGGCAGGATGGAGATCCTCCGGCGGGCCGCG
GAGATCCTCCATCGGCGGGGAGGCCCACCGTCGGCTGTGGCCACGCGCTTGCTGGAGGCG
GGCTGGTCGGGTGAGGAGTGGGCTTTCGACGTCCTCGTCGAAGCGGGAAGGCAGGCGTTC
GACGAGGGTGATTTCGTCGCTGTCATGAAGTGCTTACGGCTCGCCCTGGCGTCCGGCTGG
GGCACGCCTCGCCGGCTGGACGTGAAGGTGATGCTCGCCGCGGCGGAGTGGCGCGTCGAC
CCGGCAGTGGCGGCACGTCACGTGCCCGATCTGCTCGACGCCACGCGCTCGGGTGCGTTG
CGTGGATCTCACGGGATGGAGCTGTTCCGCCAGCTGCTGTGGTACGGCCGGTTCGCCGAC
GCGGCGGAGCTGATCGATCGGCTGAGGCCGAGCGTCGCCGACAGGGACGCCGACGCGTCC
TTGATCGCGATGTGCCACGTCCACCCGGTGCTTCTCGACAGATTGCCCCGGTCCGCCCGC
GGCTCGATGGGCCAGACAGTCGAGGACGCGCGCCGGATCCTGCGTCAGGCGGAGCCGACG
GATGAGGCGATGGACAGCATCATCTCGGCTCTGATGGCACTGCTGCTGGGCGGAGTGTCG
GAGGTGGCGGCCTCCTGCGAGACGCTCCTCAAGGAGCCCGGGGTGACGAAGGCGCCCACC
TGGAAGGCGATCATCTCCGCCATCCGGGCGGAGACGGCGTGGCGCAAGGGCGACCTGGCG
GGGGCCGAGGCCCATGCGCAGGAGGCGCTGACCATACTGCAGCCCAGCGGCTGGGGCGTC
GCGATCGGCGCGCCACTCAGCACCCTGCTCCATGCCCAGACCGCGATGGGCCACCTCGAC
GAGGCGAAGGCGACCGTGGCGGTGCCGATGCCCCGCGAGACGGCGGAGACCGCCTTCGGG
ATCGGCTACGAGCTCGCGAGGGCGCACTACCACCTGGTCACGGAGCAGCCTCGCGCCGCC
TTCGCCGGCTTCCTGGCATGCGGGCAGGCGGTCCAGCGCTGGGGCAGCAGCCTGTCCGAC
GTGGTCCCCTGGCGCCTCGGCGCGGCGCGAGCGTGCCTGCAACTGGGCTGGCGTCGCAGG
GCGGCCGATCTGGTCACGGCCCAGATCGCCCACACCTCCTCCGGTGACCTGCGGACGTAC
GGGGTCGCCCTCCGCCTGCACGCGCAGCTGAGCAAGCCCGCACAGCGCCAGCGGTTGCTG
ATGCAGTCCGTGGACGCGCTGGAGGCCGCCCAGGATCGCTACCAGCTGGCCCTTTCCCTC
TGCGACCTCGCCGGGACCCCACAGCTCAAGGGCGGCAAGGACGAGGCCCGGGCCTACTGG
GTGCGGGCGCAGGAGCTGGCCCGCGAGTGCAACGCGAAGCCCTTGATGAGGAGGCTCGCC
GCACAGCACGATCATGGTGAGACCGCACCGTTGAGCGGCGCCGAACGGCGGGTCGCCGTG
CTCGCCGCCCGTGGGCACACCAATCGTGAGATCGCCGAGGCGCTCTACATCACGCGCAGC
ACGGTCGAGCAGCATCTCACCAGGATCTATCGGAAACTCCACGTACAGACTCGGGGTGAC
CTGGGCAACCTCTTCGCCGCGGACATCGCCGATAAGGCGACGGCCACAGCCGGCCGCGAG
CCGCGTGAGGCAGTGCGGCTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [791-805]  1.49999977583352e-08 PR00038 [805-821]  1.49999977583352e-08 PR00038 [821-833]  1.49999977583352e-08 PR00038
PR00038   HTHLUXR
 [789-841]  2.2e-10 PF00196
PF00196   GerE
 [784-849]  PS50043
PS50043   HTH_LUXR_2
 [805-832]  PS00622
PS00622   HTH_LUXR_1
 [788-845]  5.29999657550189e-22 SM00421
SM00421   HTH_LUXR
IPR011990 Tetratricopeptide-like helical (Domain)
 [487-708]  1.4e-10 G3DSA:1.25.40.10 [744-799]  1.4e-10 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [238-324]  4e-08 G3DSA:1.10.10.10 [800-844]  6.40000000000001e-18 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [769-847]  1.39999892049878e-15 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit