close all open/close all

CDS information : A4092_00100


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction12,433 / 11,468 / - [in whole cluster]
12,433 / 11,468 / - [in contig]
Locationcomplement(11468..12433) [in whole cluster]
complement(11468..12433) [in contig]
TypeCDS
Length966 bp (321 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Producttranscriptional activator
Product (GenBank)putative regulator StrR family
Gene
Gene (GenBank)dbv4
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q799B3
NITE
Balhi_00040
PmId
[17693715] The border sequence of the balhimycin biosynthesis gene cluster from Amycolatopsis balhimycina contains bbr, encoding a StrR-like pathway-specific regulator. (J Mol Microbiol Biotechnol. , 2007)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
ACC
Q6ZZH8
NITE
Teicp2_00370
PmId
[22806031] Manipulating the regulatory genes for teicoplanin production in Actinoplanes teichomyceticus. (World J Microbiol Biotechnol. , 2012)
[24161919] Evaluation of heterologous promoters for genetic analysis of Actinoplanes teichomyceticus--Producer of teicoplanin, drug of last defense. (J Biotechnol. , 2013)
[25104028] The pathway-specific regulatory genes, tei15* and tei16*, are the master switches of teicoplanin production in Actinoplanes teichomyceticus. (Appl Microbiol Biotechnol. , 2014)

close this sectionSequence

selected fasta
>transcriptional activator [putative regulator StrR family]
MDPTGVDIATLPVVEIELSRLSSVYSPRTSGEDPEHVETLLSAQGELPPILVHRPTMRVI
DGLHRLKVARVRGETTISVRLIDGTESDAFVLAVEANVRHGLPLSLADRKRAAVRIIGTH
PQWSDRRVASATGISAGTVADLRRRRGQGGDEARIGRDGRIRPVDSSEGRRLAAELIRSH
PDLSLRQVAKQVGISPETVRDVRGRLEHGESPIPDGSRRLRTKPELLRRAEQDFGHVDGR
DRQAVLERLKADPALRLTETGRILLRMLSLHSIDGQEWERILRGVPPHWGTVVARCARDH
AQIWAAFADRLEGRATDLAAG
selected fasta
>transcriptional activator [putative regulator StrR family]
GTGGACCCGACGGGAGTTGACATAGCCACTCTCCCTGTCGTCGAAATCGAGCTGTCCCGG
CTGTCCTCTGTGTACTCACCCCGGACTTCGGGCGAGGATCCAGAGCACGTCGAGACCCTG
TTGTCGGCACAAGGGGAGCTTCCGCCCATTCTCGTCCACCGTCCAACGATGCGGGTGATC
GACGGCCTGCACCGGTTGAAGGTGGCGCGGGTCAGGGGTGAAACAACAATCTCGGTGAGG
CTGATCGACGGCACCGAATCGGACGCCTTCGTCCTGGCCGTCGAGGCGAACGTGCGGCAC
GGGCTGCCGCTCTCACTGGCCGACCGCAAGCGTGCGGCCGTCCGGATCATCGGGACACAT
CCGCAGTGGTCTGATCGACGGGTGGCCTCGGCGACCGGCATCTCCGCCGGCACGGTGGCC
GACCTGCGCAGGCGCAGAGGACAAGGCGGTGACGAGGCCAGAATCGGGCGGGACGGGCGC
ATCCGTCCGGTGGACAGCTCAGAGGGGAGGAGACTCGCCGCCGAGCTCATCCGCAGCCAT
CCGGACCTTTCGCTCCGCCAGGTCGCCAAACAGGTCGGCATCTCCCCGGAGACGGTCCGG
GATGTGAGAGGCCGGTTGGAGCACGGTGAGAGCCCGATTCCGGACGGGAGCCGGAGATTA
AGGACCAAGCCGGAATTACTGCGTCGGGCAGAACAGGATTTCGGCCACGTCGACGGCCGA
GACCGCCAAGCCGTGCTGGAAAGGCTCAAGGCCGATCCCGCATTACGTCTGACCGAAACC
GGCCGAATTTTGTTGCGAATGCTATCATTGCACTCCATCGACGGGCAGGAATGGGAAAGG
ATCTTGCGCGGAGTGCCGCCGCATTGGGGCACCGTTGTCGCGAGATGCGCCAGGGATCAT
GCCCAGATCTGGGCAGCGTTCGCGGATCGCCTGGAGGGGCGGGCGACCGATCTGGCCGCT
GGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [14-97]  6.80000000000001e-12 PF02195
PF02195   ParBc
 [13-100]  3.29999802154459e-10 SSF110849
SSF110849   ParBc
 [14-98]  3.69999438558106e-17 SM00470
SM00470   ParB
IPR009057 Homeodomain-like (Domain)
 [100-206]  5.20000089003336e-08 SSF46689
SSF46689   Homeodomain_like
SignalP No significant hit
TMHMM No significant hit