close all open/close all

CDS information : A4092_00110


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction13,385 / 14,494 / + [in whole cluster]
13,385 / 14,494 / + [in contig]
Location13385..14494 [in whole cluster]
13385..14494 [in contig]
TypeCDS
Length1,110 bp (369 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative prephenate dehydrogenase
Product (GenBank)putative prephenate dehydrogenase
Genedbv5
pdh
Gene (GenBank)dbv5
EC number1.3.1.-
Keyword
  • Hpg
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
Related Reference
ACC
Q04983
PmId
[7916685] An allosterically insensitive class of cyclohexadienyl dehydrogenase from Zymomonas mobilis. (Eur J Biochem. , 1993)
Family/Domain
FD
IPR003099

close this sectionSequence

selected fasta
>putative prephenate dehydrogenase [putative prephenate dehydrogenase]
MTLERTLIVGTGLIGTSAALALREKGVAVYLSDVDAHAVRLARALGAGQEWTGQRVDLAL
IAVPPPSVGQRLADLQQRRAARAYTDVTSVKVDPIADAERLGCDLTSYVPGHPLAGRERS
GPAAARADLFLGRPWALCPRPETGADAVRLARELVSMCGAEPYTVSAGEHDTAVALVSHA
PHVAASAVAARLRDGDDVALALAGQGLRDVTRIAAGDPLLWRMILAANALPVAGVLERIA
ADLAAAASALRSGDLDDVTDLLRRGVDGHGRIPDKHGGPARDYTVIQVVLQDRPGELARL
FNAAGLADVNIEDIRLEHSAGLPVGVVEVSVRPEDTGRLTEALRFHGWHVPPVPDGNSRI
DRTRAMVSD
selected fasta
>putative prephenate dehydrogenase [putative prephenate dehydrogenase]
GTGACCCTGGAGAGGACGCTCATCGTCGGCACCGGTCTGATCGGCACCTCCGCCGCGCTC
GCCCTTCGCGAGAAGGGGGTGGCGGTCTACCTGTCCGACGTCGACGCACATGCCGTACGG
CTGGCGCGAGCGCTCGGCGCGGGCCAGGAGTGGACCGGTCAGCGCGTGGACCTGGCATTG
ATCGCCGTGCCCCCGCCCAGCGTGGGGCAGCGGCTGGCCGATCTGCAGCAGCGGCGGGCC
GCGCGGGCGTACACCGATGTGACCAGCGTCAAGGTCGATCCGATCGCCGACGCGGAGCGG
CTCGGCTGCGACCTGACCTCCTATGTCCCCGGACACCCGCTCGCCGGCCGGGAGCGGTCC
GGCCCGGCCGCCGCCCGTGCCGATCTGTTCCTGGGACGTCCCTGGGCGCTCTGCCCCCGC
CCTGAGACGGGTGCGGATGCCGTGCGGCTGGCCAGGGAGCTGGTCTCGATGTGCGGGGCG
GAGCCCTACACCGTGAGTGCGGGCGAGCACGACACGGCGGTGGCGCTGGTGTCGCACGCC
CCGCACGTGGCCGCGTCCGCGGTGGCGGCGCGGCTGAGGGACGGCGACGACGTCGCGCTG
GCCCTGGCGGGGCAGGGGCTGCGCGACGTGACGCGGATCGCCGCAGGGGACCCCCTGCTG
TGGCGGATGATTCTCGCCGCGAACGCCCTGCCGGTGGCCGGGGTGCTGGAGCGGATCGCG
GCCGATCTCGCCGCGGCGGCCTCGGCGCTGCGGTCCGGCGATCTCGACGATGTGACGGAT
CTGCTGCGGCGCGGCGTGGACGGCCACGGCCGGATCCCCGACAAGCACGGCGGCCCGGCG
CGTGACTACACGGTGATCCAGGTGGTGCTGCAGGATCGGCCGGGAGAGCTGGCGAGGCTC
TTCAACGCGGCGGGGCTCGCGGACGTCAACATCGAGGACATCCGCCTGGAGCACTCGGCC
GGCCTGCCGGTCGGGGTGGTCGAGGTCTCCGTGCGCCCGGAGGACACCGGCCGGCTCACC
GAGGCACTGCGCTTCCACGGCTGGCACGTCCCGCCCGTCCCCGACGGCAACTCGAGGATC
GACCGGACGCGAGCTATGGTGTCAGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002912 ACT domain (Domain)
 [284-344]  1.6e-07 PF01842
PF01842   ACT
IPR003099 Prephenate dehydrogenase (Domain)
 [18-263]  3.10000000000005e-76 PF02153
PF02153   PDH
 [4-280]  PS51176
PS51176   PDH_ADH
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [166-274]  4.90001027782405e-27 SSF48179
SSF48179   6DGDH_C_like
IPR016040 NAD(P)-binding domain (Domain)
 [2-171]  1.69999999999999e-22 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit