close all open/close all

CDS information : A4092_00120


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction14,522 / 15,175 / + [in whole cluster]
14,522 / 15,175 / + [in contig]
Location14522..15175 [in whole cluster]
14522..15175 [in contig]
TypeCDS
Length654 bp (217 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system response regulator
Product (GenBank)putative response regulator
Gene
Gene (GenBank)dbv6
EC number
Keyword
Note
  • this ORF is not involved in A40926 biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
P0A4I2
PmId
[8885276] The cutRS signal transduction system of Streptomyces lividans represses the biosynthesis of the polyketide antibiotic actinorhodin. (Mol Microbiol. , 1996)

close this sectionSequence

selected fasta
>putative two-component system response regulator [putative response regulator]
MRVLVVEDQVDLADSVARVLRREGMAVDVSHDGDDAQERLSVIDYDVVVLDRDIPGVHGD
ELCAEIAVDDRRTRVLMLTASGTTADRVAGLSLGADDYLPKPFAFAELVARIRALGRRAH
PPAPPILVHGDLRLDPAQRVAIRGGMRLPLTTKELAVLEHLLTARGRVVSAEELLERVWD
EQADPFTTTVKATINRLRSKLGQPPVIETVPREGYRI
selected fasta
>putative two-component system response regulator [putative response regulator]
ATGCGCGTTCTGGTGGTGGAGGACCAAGTCGACCTGGCCGACTCGGTGGCGCGGGTGCTG
CGTCGCGAGGGCATGGCCGTCGATGTCAGTCATGACGGCGATGACGCACAGGAGCGCCTC
TCCGTGATCGACTACGACGTCGTGGTGCTTGATCGGGATATTCCCGGCGTCCATGGCGAC
GAGCTGTGCGCTGAGATCGCCGTGGACGATCGCAGGACCCGGGTGCTGATGCTCACCGCG
TCCGGGACGACCGCTGACCGGGTGGCGGGCCTGAGCCTGGGCGCCGACGACTATCTGCCG
AAGCCGTTCGCCTTCGCCGAGCTGGTGGCGCGCATCCGCGCCCTGGGCAGGCGCGCGCAT
CCTCCCGCGCCGCCGATCCTGGTCCACGGCGACCTGCGGCTCGATCCGGCGCAACGGGTG
GCGATCAGGGGCGGCATGCGGCTGCCGCTGACCACCAAGGAGCTGGCGGTCCTGGAGCAT
CTGCTGACCGCGCGCGGCCGGGTGGTGTCGGCCGAGGAGCTGCTCGAACGGGTCTGGGAC
GAGCAAGCCGACCCGTTCACCACCACCGTGAAGGCGACGATCAACCGGCTGCGCTCGAAG
CTCGGCCAGCCGCCGGTGATCGAAACCGTCCCGCGCGAGGGATATCGCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [1-112]  1.70000295590053e-34 SM00448
SM00448   REC
 [3-113]  1.1e-23 PF00072
PF00072   Response_reg
 [2-116]  PS50110
PS50110   RESPONSE_REGULATORY
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [145-217]  3.0999994589937e-24 SM00862
SM00862   Trans_reg_C
 [147-217]  2.2e-20 PF00486
PF00486   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [1-187]  6.79998707392899e-35 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [122-217]  1.2e-25 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit