close all open/close all

CDS information : A4092_00140


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction16,869 / 15,910 / - [in whole cluster]
16,869 / 15,910 / - [in contig]
Locationcomplement(15910..16869) [in whole cluster]
complement(15910..16869) [in contig]
TypeCDS
Length960 bp (319 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductN-acyltransferase
Product (GenBank)Dbv8 protein
Gene
Gene (GenBank)dbv8
EC number2.3.1.-
Keyword
  • N-acyl-aminoglucuronic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[15664522] Tailoring of glycopeptide scaffolds by the acyltransferases from the teicoplanin and A-40,926 biosynthetic operons. (Chem Biol. , 2005)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25095906] Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus. (J Am Chem Soc. , 2014)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionSequence

selected fasta
>N-acyltransferase [Dbv8 protein]
MDAESVRRQLRLGENATAWLSRLEELGPPPEPVRLPQGDEARDLLHRLEVPAPDVEEIVA
ATPGPDRDPALWWLLERAHHELVRHMGDYKVKVRGGPTLPYETGAAARYFHVYVFLATLP
ALRRFHATRDIPEATTWETLTQLGESVAIHRRKYGEGGTNMPWWLTLLVRGLVYRLGRLQ
YNLAVAKDGTPVLGLHIPEVGGPLIPDIYYDSLRRARPFFERHFPEHGARAATGTSWLLD
PQLAEYLAEDSHILQLRRGWTLLDSEPQDGDDAILEFVFRYNGQPLEELPQRSTLEKAVV
THLLAGRHWYQRSGRIELP
selected fasta
>N-acyltransferase [Dbv8 protein]
ATGGATGCTGAGAGCGTGCGCAGGCAGCTGCGGCTGGGAGAGAACGCCACGGCGTGGCTC
TCCCGGCTCGAGGAGCTCGGACCGCCCCCCGAGCCGGTGCGCCTGCCTCAGGGCGATGAG
GCTCGTGATCTCTTACACCGGCTGGAGGTGCCGGCTCCCGACGTCGAGGAGATCGTGGCG
GCCACCCCCGGCCCGGATCGCGACCCGGCCCTGTGGTGGCTGCTCGAACGCGCCCACCAC
GAGCTCGTCCGGCACATGGGCGACTACAAGGTGAAGGTACGGGGTGGGCCGACCCTGCCG
TACGAGACCGGGGCCGCCGCCCGCTACTTCCACGTGTACGTCTTCCTCGCGACGCTTCCG
GCGTTGCGGCGCTTCCACGCGACACGGGACATCCCCGAGGCGACCACCTGGGAGACCCTG
ACGCAGCTGGGGGAATCGGTGGCCATCCATCGCCGCAAGTACGGCGAGGGCGGCACGAAC
ATGCCGTGGTGGCTCACCCTGCTCGTGCGCGGCCTGGTCTACCGGCTCGGCCGGCTCCAG
TACAACCTGGCCGTCGCCAAGGACGGCACGCCCGTCCTCGGCCTGCACATCCCCGAAGTG
GGCGGGCCGCTGATCCCCGACATCTATTACGACTCGCTCCGTCGTGCCCGCCCGTTCTTC
GAACGGCATTTTCCCGAGCACGGCGCCCGGGCGGCGACAGGCACCTCGTGGCTGCTCGAT
CCGCAGCTGGCCGAGTATCTCGCCGAGGACTCCCACATCCTGCAGCTCAGACGCGGCTGG
ACGCTCCTCGACTCCGAACCGCAGGACGGGGACGACGCGATCCTGGAGTTCGTCTTCCGC
TACAACGGCCAGCCGCTGGAGGAGCTTCCGCAGCGCTCGACGCTGGAGAAGGCGGTCGTC
ACCCATTTGCTGGCGGGCCGTCACTGGTATCAGCGGAGCGGCCGCATCGAGCTGCCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit