close all open/close all

CDS information : A4092_00150


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction18,098 / 16,872 / - [in whole cluster]
18,098 / 16,872 / - [in contig]
Locationcomplement(16872..18098) [in whole cluster]
complement(16872..18098) [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
UDP-N-acetyl-glucosamine transferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)dbv9
EC number
Keyword
  • Hpg4
  • N-acyl-aminoglucuronic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q6ZZI3
NITE
Teicp_00250
PmId
[17009278] Identification of a deacetylase involved in the maturation of teicoplanin. (Chembiochem. , 2006)
ACC
Q6ZZI3
NITE
Teicp2_00320
PmId
[14702401] Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus. (Microbiology. , 2004)
[17661468] Kinetic analysis of teicoplanin glycosyltransferases and acyltransferase reveal ordered tailoring of aglycone scaffold to reconstitute mature teicoplanin. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>glycosyltransferase [glycosyltransferase]
MRVLLSTSGSRGDVEPLLGLAVQLRELGAETRMCAPPDCAERLAEAGVPLVPVGTSMRAK
LHGKRPPSLEDVPRLDAEAIATQLDQVLPAAEGCEVMVVSGVLSAAVAVRSVAEKLGIPY
VYVFYCPIYVPSPYYPPPPPLGEQPARDVTDNRVLWDRNNQGAYQRFGAALNSRRASIGL
PPVDDIFSYGYTDRPFLAADPVLAPLQRTDLDVVQTGAWIMPDERPLPAEVEAFLEAGPP
PVHVEFGSGPAPTDAARVAIEAIRAHGHRVIVSRGWAGLAPPDDRSDCLTVGEVNHQVLF
GRVAAVVHAGSAGITTAVTRAGAPQVVVPQMTDQPYHAGRVAELGIGVAHDGRVPTVESL
SAALTTALAPETRARAIDVAGKIRADGAAVAAKLLLDTAAGAGRNRTE
selected fasta
>glycosyltransferase [glycosyltransferase]
ATGCGCGTGTTGTTGTCGACGTCCGGATCACGCGGGGACGTCGAACCGCTGCTGGGCCTG
GCGGTCCAGCTGCGTGAGCTAGGCGCGGAGACACGGATGTGCGCCCCGCCGGACTGCGCG
GAGAGACTGGCCGAGGCCGGGGTGCCGCTGGTGCCGGTCGGCACCTCGATGCGCGCGAAG
CTGCACGGGAAGAGGCCGCCCTCGCTCGAGGACGTGCCCCGGCTCGACGCCGAGGCCATC
GCCACGCAGCTCGACCAGGTCCTGCCGGCCGCCGAGGGGTGCGAGGTGATGGTGGTGAGC
GGCGTGCTGTCGGCGGCGGTCGCCGTCCGGTCGGTGGCCGAGAAGCTCGGCATCCCCTAC
GTCTACGTCTTCTACTGCCCCATCTATGTGCCGTCGCCGTACTACCCGCCGCCGCCACCC
CTCGGTGAGCAGCCCGCGCGGGACGTGACCGACAACCGGGTGCTGTGGGACCGCAACAAC
CAGGGCGCCTACCAGCGGTTCGGTGCCGCGCTCAACAGCCGGCGGGCCTCGATCGGCCTG
CCGCCGGTGGACGACATCTTCAGCTACGGCTACACCGATCGCCCCTTCCTGGCCGCGGAC
CCGGTCCTGGCCCCGCTGCAGCGGACGGACCTCGACGTCGTGCAGACCGGTGCGTGGATC
ATGCCCGACGAACGGCCCCTGCCCGCCGAGGTGGAGGCGTTCCTGGAGGCCGGCCCGCCA
CCGGTGCACGTGGAGTTCGGCAGCGGGCCCGCCCCCACCGACGCCGCGAGGGTGGCCATC
GAGGCGATCCGGGCCCATGGCCACCGGGTGATCGTCTCCCGTGGCTGGGCCGGCCTAGCC
CCGCCCGACGACCGGAGCGACTGCCTGACCGTCGGCGAGGTGAACCACCAGGTGTTGTTC
GGCCGGGTGGCCGCCGTCGTCCACGCCGGCAGCGCGGGCATCACGACCGCGGTCACCCGG
GCGGGCGCTCCCCAGGTCGTGGTGCCCCAGATGACCGACCAGCCGTACCACGCCGGCCGG
GTGGCCGAGCTGGGCATCGGCGTGGCACACGACGGGCGGGTGCCGACCGTGGAGAGCCTG
TCGGCCGCGCTCACCACGGCGCTGGCTCCCGAGACCCGCGCGCGGGCGATCGACGTGGCC
GGGAAGATCCGCGCCGACGGGGCGGCCGTGGCCGCGAAACTCCTGCTCGACACGGCCGCC
GGGGCCGGGCGGAACAGAACGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002213 UDP-glucuronosyl/UDP-glucosyltransferase (Family)
 [304-369]  0.00015 PF00201
PF00201   UDPGT
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-133]  3.09999999999998e-25 PF03033
PF03033   Glyco_transf_28
SignalP No significant hit
TMHMM No significant hit