close all open/close all

CDS information : A4092_00170


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction20,907 / 19,681 / - [in whole cluster]
20,907 / 19,681 / - [in contig]
Locationcomplement(19681..20907) [in whole cluster]
complement(19681..20907) [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative oxygenase OxyC
Genedbv11
oxyC
Gene (GenBank)dbv11
EC number
Keyword
  • 4th cross-linking
  • AB ring
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q70AY6
NITE
Teicp2_00310
PmId
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)
ACC
Q8KLM1
NITE
A4793_00050
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative oxygenase OxyC]
MDDDIDAGAPVLQPTANYMMRTHCDPHEDMFALRAHGPLVRIGGDAATQLRVDYVWQALG
YDVVRRILGDHENFTTRPRWSSAPSIAGEPIPPNLVGQLSVYDPPEHTRLRGMLTPEFTA
RRIRRLEPAMQDLIDDRIDELEAAGPPADVQALFADPVGGGVLCELLGIPRDDRIEFIRR
VRQNVDLSRGFKARAADSAAFNRYLNGLIIRQRKDPDEGFIGMLVREHGDDVTDEELKGV
LTALILGGVETVAGSIGFGVLALLDHPDQRQSLFAGREEADRVVGELLRFLSPVQQPNPR
LAVRDVVVDGQLIKAGDYVLCSILMANRDEALTPNANVLDVRRDCGSHVGFGHGIHYCIG
AAIARTLLRMAYQSLWRRFPGLRLAVSAEEVKFRNAFIDCPDELPVTW
selected fasta
>putative cytochrome P450 [putative oxygenase OxyC]
ATGGATGACGATATCGATGCGGGCGCGCCGGTCCTGCAGCCGACGGCGAACTACATGATG
CGGACGCACTGTGATCCGCATGAGGACATGTTCGCGCTCAGGGCGCATGGCCCACTGGTC
CGGATAGGCGGTGACGCGGCCACTCAGCTGCGTGTCGACTATGTCTGGCAGGCTTTGGGA
TACGACGTCGTGCGCAGAATACTCGGCGATCACGAGAACTTCACGACGCGCCCCCGGTGG
AGTTCGGCGCCATCGATCGCCGGAGAGCCCATACCGCCGAATCTGGTCGGTCAGCTGTCG
GTCTATGATCCGCCCGAGCACACGCGGCTGCGCGGGATGCTGACCCCGGAGTTCACGGCC
CGCCGGATCCGCCGGCTGGAGCCCGCCATGCAGGACCTCATCGATGACCGCATCGACGAG
CTGGAGGCCGCGGGGCCGCCCGCGGACGTCCAGGCGCTGTTCGCCGATCCGGTCGGCGGA
GGAGTGCTGTGTGAGCTGCTCGGCATCCCGCGTGATGATCGGATCGAGTTCATCCGGCGT
GTCAGGCAGAACGTCGATCTCAGCCGCGGGTTCAAGGCCCGGGCGGCCGACAGCGCGGCG
TTCAACCGGTATCTGAACGGCCTCATCATCCGGCAGCGGAAGGACCCTGACGAGGGGTTC
ATCGGGATGCTGGTGCGGGAGCACGGAGACGATGTCACGGACGAGGAGCTGAAGGGCGTA
CTCACGGCGCTGATCCTGGGTGGTGTCGAAACCGTCGCGGGGTCGATCGGCTTCGGGGTT
CTCGCGCTGCTGGATCATCCCGACCAGCGACAGTCTCTCTTCGCCGGACGCGAGGAGGCC
GACCGGGTGGTCGGTGAGCTGCTGCGGTTCCTGTCGCCCGTGCAGCAGCCGAATCCACGG
CTCGCCGTCCGGGACGTGGTCGTCGACGGCCAGCTGATCAAGGCCGGGGATTACGTCCTG
TGCTCGATTCTGATGGCGAATCGCGACGAGGCGCTGACGCCGAATGCCAACGTCCTCGAC
GTGCGCCGTGACTGCGGCTCGCACGTCGGGTTCGGGCACGGCATCCATTACTGCATAGGC
GCGGCGATAGCCAGGACGCTGCTGCGCATGGCGTATCAGAGTTTGTGGCGCCGGTTTCCC
GGGCTGCGCCTGGCGGTGTCCGCCGAGGAAGTGAAGTTCCGTAACGCGTTCATCGATTGC
CCGGACGAGTTGCCGGTCACCTGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [8-408]  2e-91 G3DSA:1.10.630.10
G3DSA:1.10.630.10   no description
 [3-408]  1.3e-89 SSF48264
SSF48264   Cytochrome P450
 [221-379]  7e-14 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [102-113]  3.6e-43 PR00359 [149-165]  3.6e-43 PR00359 [166-181]  3.6e-43 PR00359 [203-225]  3.6e-43 PR00359 [282-293]  3.6e-43 PR00359 [300-327]  3.6e-43 PR00359 [328-343]  3.6e-43 PR00359 [349-358]  3.6e-43 PR00359 [358-369]  3.6e-43 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [351-360]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit