close all open/close all

CDS information : A4092_00190


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction23,365 / 22,211 / - [in whole cluster]
23,365 / 22,211 / - [in contig]
Locationcomplement(22211..23365) [in whole cluster]
complement(22211..23365) [in contig]
TypeCDS
Length1,155 bp (384 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative monooxygenase
Genedbv13
oxyE
Gene (GenBank)dbv13
EC number
Keyword
  • 2nd cross-linking
  • F-O-G ring
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q6ZZI7
NITE
Teicp_00210
PmId
[20974107] Structural characterization of CYP165D3, a cytochrome P450 involved in phenolic coupling in teicoplanin biosynthesis. (Arch Biochem Biophys. , 2011)
[21445994] Crystal structure of a phenol-coupling P450 monooxygenase involved in teicoplanin biosynthesis. (Proteins. , 2011)
ACC
Q6ZZI7
NITE
Teicp2_00280
PmId
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
ACC
Q8KLL8
NITE
A4793_00080
PmId
[17884639] The biosynthesis of teicoplanin-type glycopeptide antibiotics: assignment of p450 mono-oxygenases to side chain cyclizations of glycopeptide a47934. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative monooxygenase]
MVVPLPHQRLRLDPVPALFDLQEDGPLHEYDTEPGLDGHKQWLVTGYGEIREILADANRF
SSMRPVEDEAERAWLPGILQSYDAPDHTRLRRTVTRANTARRIESLRPVVEETVEDCLAD
LESMGSPVDFVRNAAWPIPALIACDFLGVPRDDQAELSRMFRDSRESRVPRQRNVSGLGI
VDYARKLAARERLDPGTGMIGGIVREHGGEVTDEELAGLVEGIMIGAVEQMASQLAIAVL
LLVTHPDQMALLRERPELADSAAEEVFRYASIVETPSPRTALVDTRLAGRDIHAGDVLTC
SILAGNRAREDRFDLTRGNPEHLAFGHGVHFCLGAPLARLQAQVALPALVRRFPSLRLAV
PAEDLRFKPGKPAPFAVEELPVEW
selected fasta
>putative cytochrome P450 [putative monooxygenase]
ATGGTGGTTCCGCTGCCGCATCAGCGGCTGAGGCTCGATCCCGTGCCGGCGCTCTTCGAC
CTGCAAGAGGACGGGCCGCTGCACGAGTACGACACCGAGCCGGGGCTGGACGGCCACAAG
CAGTGGCTCGTCACCGGATATGGCGAGATCAGAGAGATTCTCGCCGACGCCAACCGGTTC
AGCTCGATGCGCCCGGTCGAGGACGAGGCGGAGCGCGCCTGGCTGCCGGGAATCCTGCAG
TCGTACGACGCGCCCGATCACACCCGGTTGCGCAGGACCGTGACCAGGGCGAACACCGCC
CGGCGGATCGAGAGCCTGCGGCCTGTCGTCGAAGAGACCGTCGAGGACTGCTTGGCCGAT
CTGGAGAGCATGGGGTCGCCGGTCGACTTCGTCAGGAACGCCGCCTGGCCCATCCCGGCG
CTGATCGCCTGCGACTTCCTCGGCGTCCCCCGTGACGACCAGGCCGAGCTGTCGAGGATG
TTCCGGGACAGCCGGGAGAGCCGAGTCCCCAGGCAGCGGAACGTGTCGGGCCTGGGCATC
GTCGACTACGCCAGGAAACTGGCGGCTCGCGAACGCCTCGATCCCGGCACCGGGATGATC
GGCGGCATCGTGCGCGAGCACGGAGGCGAGGTCACCGACGAGGAGCTGGCGGGGCTCGTC
GAGGGGATCATGATCGGGGCGGTCGAGCAGATGGCCTCGCAGCTGGCGATCGCGGTGCTC
CTCCTCGTGACCCACCCCGACCAGATGGCGCTGCTGCGCGAGCGTCCGGAGCTCGCGGAC
AGCGCGGCCGAGGAGGTGTTCCGCTACGCGTCGATCGTCGAGACCCCCTCTCCCCGGACC
GCACTGGTCGACACGCGCCTGGCCGGACGGGACATCCACGCCGGTGATGTCCTGACCTGC
TCGATCCTGGCGGGCAATCGTGCGCGCGAGGACCGCTTCGACCTCACCCGGGGCAACCCC
GAACACCTCGCGTTCGGGCACGGCGTCCACTTCTGCCTCGGGGCACCGCTGGCCAGGCTC
CAGGCGCAAGTGGCGTTGCCGGCGTTGGTCCGCCGGTTCCCGTCGCTGCGGCTGGCGGTC
CCGGCAGAGGACCTGCGGTTCAAACCGGGGAAGCCGGCCCCCTTCGCCGTGGAGGAGCTT
CCCGTTGAGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [11-384]  2.99998750445706e-76 SSF48264
SSF48264   Cytochrome_P450
 [9-384]  1.9e-83 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [206-353]  2.1e-14 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [82-93]  2.49999811956465e-28 PR00359 [129-145]  2.49999811956465e-28 PR00359 [146-161]  2.49999811956465e-28 PR00359 [182-204]  2.49999811956465e-28 PR00359 [261-272]  2.49999811956465e-28 PR00359 [323-332]  2.49999811956465e-28 PR00359 [332-343]  2.49999811956465e-28 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [325-334]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit