close all open/close all

CDS information : A4092_00220


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction30,461 / 24,870 / - [in whole cluster]
30,461 / 24,870 / - [in contig]
Locationcomplement(24870..30461) [in whole cluster]
complement(24870..30461) [in contig]
TypeCDS
Length5,592 bp (1,863 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative non-ribosomal peptide synthetase, module 7
Gene
Gene (GenBank)dbv16
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
ACC
Q939Y9
NITE
Balhi_00090
PmId
[11932455] Nonribosomal biosynthesis of vancomycin-type antibiotics: a heptapeptide backbone and eight peptide synthetase modules. (Microbiology. , 2002)
[15651041] The biosynthesis of vancomycin-type glycopeptide antibiotics--a model for oxidative side-chain cross-linking by oxygenases coupled to the action of peptide synthetases. (Chembiochem. , 2005)
[17506888] Phylogenetic analysis of condensation domains in NRPS sheds light on their functional evolution. (BMC Evol Biol. , 2007)
ACC
Q70AZ6
NITE
Teicp2_00210
PmId
[25686610] X-domain of peptide synthetases recruits oxygenases crucial for glycopeptide biosynthesis. (Nature. , 2015)
[26549530] Sequential In Vitro Cyclization by Cytochrome P450 Enzymes of Glycopeptide Antibiotic Precursors Bearing the X-Domain from Nonribosomal Peptide Biosynthesis. (Angew Chem Int Ed Engl. , 2015)
[27213615] Regulation of the P450 Oxygenation Cascade Involved in Glycopeptide Antibiotic Biosynthesis. (J Am Chem Soc. , 2016)

close this sectionPKS/NRPS Module

A7 L-3,5-dihydroxyphenylglycine(Dpg)
C15..310
A494..894
PCP976..1043
X1057..1355
TE1624..1841

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, module 7]
MTIDDTRAKPRSSVEDVWPLSPLQEGMLYHTALDDDGPDTYTVQTVYGIDGPLDAGRLRA
SWQALVDRHAALRAYFRYVSGAQMVQVIAREAEIPWRETDLHGLPDDLLDSEVDRLAADE
LAERLPLDAAPLMKLHLIRLGPASHRLVHTLHHVLLDGWSMPILHRELAAIYAAGGDASG
LPAAVSYRDYLAWLGRQDKEAARAAWRQELAGLDTPTLVAPADPARVPDMGTAVIELSAE
LTDGLARLARGHGLTLNTVVQGAWAMVLAQLAGRTDVVFGATASGRPAELAGVESMVGQL
LGTLPVRVRLEGGRRVVELLAELQRSQSALMAHQHLGLQEMQAAVGPGAVFDTLVIYENF
PRQGLGRAEEDGGLDLRPVRRGRNSSHYPFTLITGPGAQMPLILDYDRGLFDEAAAESVV
GALARVLERLVAEPDVLVGRLTLLSEAERALVVEDWNATAGPTPGQSVLDLFGRRVATAP
DAVAITDAGGADLTYAEVDQAANRLARHLAARGIGRGDRVGVVMDRSPDLLIAFLASWKA
GAAYVPVDVEHPAERIEFVLADSGVSAVLCTRATREVAPADAIVIDAPETRAAIDAGAAT
APQIRLSADDLAYVMYTSGSTGLPKGVGVPHGAVAGLAGDEGWRIGPGDAVLMHATHVFD
PSLYAMWVPLAMGGRVVLTEPGVLDALGMRQAVERGVTFVHLTAGTFRALAESSPECFAG
LVEVGTGGDVVPAQSVEHLRRAVPGLRVRNTYGPTETTLCATWKPIEPGEEVGRELPIGR
PMTNRRIYILDAFLRPVAPGVAGELYIAGTGLARGYLGGPGLTAERFVAVPASVDPSPGE
RMYRTGDLARWNRDGEVVFLGRTDDQVKIRGYRVELGEVEAVLAAQRGVVEAVVVAREDQ
PGEKRLVGYFISDGTDAGPAEIRREMALVLPAYMVPLAVVALPALPVTPNGKVDRLALPA
PDLVGRAPDRAQESETEKVLCALFAEILGVDRVGVDDAFHDLGGSSALAMRLIARIREEL
GADLPIRQLFSAATPAGVARALAAKSRPALEPAERPGRVPLTAQQLSAWLLASPGEAAGL
HVSVALRLRGRLDVPALEAALGDVAARHEILRTTFPGHAQSVHQHVHDASPVDLTPVPAT
EESLPGLLTELRESVFDLTREVPWRGDLFRLSDGEHVLHLMVHRILADDESLDVFLRDLS
AAYGARRAGRAPERAPLTLQFADYAIWERRLLEGERDADGLINEQLVFWRDNLAGIHGET
VLPFDRPRSAVASRRAGTVSLRLDAGPHARLVEAVDPIGAHPFQIVHAALAMLLTRLGAG
HDLVIGTKLPRDDDLIDLEPMIGPFARPLALRTDLSGDPTFLEVVTRAQEAIRSARQHLD
VPFARIVELLDLPVSLSRHPVFQVGLEVHEEDLGAWDATELPALRTSVEPVGPEAIELDL
AFRLTERRDEDGIEGTLHYAADLFDQATAESLARRLVSFLEQVAEDPQRRVSDLDVLLDD
AERERPAEAPAKWSEAVPPVAADLAEGGPLGALVLDDRLRPAVAVGELYLTGAAVDAEPG
DRTLACPFGATGRRMLPTGLLARWTAGGTLVVVGERRGSSGSVKTGTGDFEVLLPLRAGG
NRPPLYCVHASGGLSWNYAPLLRSLPPNQPVYGVQARGLARTEPLAAGVEEMAADYVEQI
RAVQPTGPYHLLGWSLGGRIAQEMARVLEEQGEQVGLLALLDAYPTDVGRLRRPRGDAAD
QEAADFDRQQEQQAQLAAAVATEAGARKRLDEVMEHLARVGPLHTSRSFGCDILLFVATV
NRPSHLPVADAIASWRPLTTGTVEPHEIEIDHMQMLQPAALARIGAVVAEKLRPRPDGER
TQR
selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, module 7]
GTGACCATTGACGACACTCGTGCGAAGCCGCGCTCCAGCGTGGAAGACGTCTGGCCCCTC
TCGCCGCTGCAGGAGGGCATGCTCTATCACACCGCCCTCGACGACGACGGGCCCGACACC
TACACGGTGCAGACCGTGTACGGCATCGACGGCCCGCTGGACGCCGGGCGGCTGAGGGCG
TCGTGGCAGGCGCTCGTGGACCGGCATGCCGCGCTGCGGGCCTATTTCCGCTATGTCAGC
GGCGCGCAGATGGTGCAGGTCATCGCGCGGGAGGCGGAGATCCCCTGGCGTGAAACGGAT
CTCCACGGGCTGCCGGACGACCTCCTCGACAGCGAGGTGGACCGGCTGGCGGCGGACGAG
CTGGCCGAGCGGCTCCCCCTCGATGCGGCACCGCTGATGAAGCTGCACCTCATCCGGCTC
GGCCCGGCCAGCCACCGGCTCGTGCACACCCTGCACCATGTCCTGCTGGACGGCTGGTCG
ATGCCGATCCTGCACCGCGAGCTGGCCGCGATCTACGCGGCGGGCGGCGACGCGTCCGGG
CTGCCTGCCGCCGTGTCCTACCGGGACTACCTCGCCTGGCTGGGCCGGCAGGACAAGGAG
GCGGCCCGGGCGGCCTGGCGGCAGGAGCTCGCCGGACTGGACACGCCCACGCTGGTCGCC
CCGGCCGATCCGGCCCGCGTGCCGGACATGGGCACCGCGGTGATCGAGCTCTCCGCGGAG
CTGACGGACGGGCTGGCGCGGCTGGCGCGCGGCCACGGCCTCACCTTGAACACCGTCGTC
CAGGGTGCGTGGGCCATGGTCCTGGCGCAGCTCGCCGGCCGCACCGACGTGGTGTTCGGC
GCGACCGCCTCGGGGCGGCCCGCCGAGCTGGCCGGTGTGGAGTCGATGGTCGGGCAGCTG
CTCGGCACCCTGCCGGTACGGGTCCGGCTCGAAGGCGGCCGGCGGGTCGTCGAGCTGCTC
GCCGAGCTGCAGCGCAGCCAGTCGGCACTCATGGCGCACCAGCATCTCGGCCTGCAGGAG
ATGCAGGCCGCCGTCGGGCCCGGGGCGGTCTTCGACACGCTCGTCATCTACGAGAACTTC
CCGCGCCAGGGACTCGGCCGGGCCGAAGAGGACGGCGGCCTGGACCTGAGACCGGTGCGG
CGCGGACGCAACTCCTCGCACTACCCGTTCACCCTGATCACCGGGCCCGGCGCGCAGATG
CCGCTCATCCTCGACTACGACCGCGGCCTCTTCGACGAGGCGGCCGCCGAATCGGTCGTG
GGCGCGCTGGCTCGCGTGCTTGAGCGGCTGGTCGCCGAGCCCGACGTCCTCGTCGGCCGG
CTGACGCTGCTGAGCGAAGCCGAGCGCGCCCTGGTGGTGGAGGACTGGAACGCGACGGCG
GGCCCCACGCCGGGGCAGTCCGTGCTCGATCTCTTCGGACGGCGGGTGGCCACGGCGCCG
GACGCGGTGGCGATCACCGATGCCGGCGGCGCGGACCTGACCTACGCCGAGGTCGACCAG
GCGGCGAACCGGCTGGCCCGCCACCTCGCCGCTCGTGGCATCGGCCGTGGCGACCGCGTC
GGCGTGGTCATGGACAGGTCGCCTGACCTGCTGATCGCGTTCCTGGCGAGCTGGAAGGCG
GGCGCCGCGTACGTCCCGGTGGACGTCGAGCACCCGGCCGAGCGGATCGAGTTCGTGCTC
GCCGACTCCGGTGTCTCGGCCGTCCTGTGCACCCGGGCCACCAGGGAAGTGGCGCCGGCG
GACGCGATCGTCATCGACGCCCCGGAGACCCGCGCGGCCATCGACGCGGGTGCCGCCACG
GCGCCGCAGATCCGGCTGAGCGCCGACGACCTGGCGTACGTGATGTACACCTCCGGCTCC
ACCGGCCTGCCGAAGGGGGTGGGCGTCCCCCATGGGGCCGTGGCCGGCCTGGCGGGCGAC
GAGGGCTGGCGGATCGGCCCGGGCGACGCCGTGCTGATGCACGCGACGCACGTCTTCGAC
CCTTCGCTCTACGCGATGTGGGTGCCGCTCGCCATGGGTGGCCGGGTCGTGCTCACCGAG
CCGGGAGTGCTGGACGCGCTCGGGATGAGACAGGCCGTCGAACGGGGCGTGACCTTCGTC
CATCTCACCGCCGGTACCTTCCGGGCCCTCGCGGAGTCGTCCCCGGAGTGTTTCGCGGGC
CTGGTCGAGGTCGGGACCGGTGGTGACGTGGTTCCGGCGCAGTCCGTGGAGCACCTGCGG
CGGGCCGTGCCCGGCCTGCGGGTGCGCAACACGTACGGACCGACCGAGACCACCCTGTGC
GCGACGTGGAAGCCGATCGAGCCCGGCGAGGAGGTCGGGCGGGAGCTGCCGATCGGCCGT
CCCATGACCAACCGCAGGATCTACATCCTGGACGCCTTCCTGCGCCCGGTCGCGCCGGGG
GTGGCGGGCGAGCTGTACATCGCGGGCACCGGGCTGGCCCGCGGGTATCTCGGCGGGCCG
GGCCTGACGGCAGAGCGGTTCGTGGCCGTTCCGGCCTCCGTGGACCCTTCTCCTGGTGAG
CGCATGTACCGCACCGGCGACCTGGCGCGCTGGAACCGCGACGGCGAGGTGGTGTTCCTC
GGCCGCACCGACGACCAGGTGAAGATCCGCGGCTACCGGGTGGAGCTCGGCGAGGTGGAG
GCCGTGCTGGCGGCCCAGCGCGGCGTGGTCGAGGCGGTCGTCGTGGCGCGGGAGGACCAG
CCGGGCGAGAAGCGCCTGGTCGGCTACTTCATCTCCGACGGAACCGATGCGGGGCCGGCG
GAGATCCGGCGGGAGATGGCCCTGGTCCTGCCCGCGTACATGGTTCCCCTGGCGGTCGTC
GCCCTGCCCGCGCTGCCTGTCACGCCCAACGGCAAGGTGGATCGCCTGGCTCTGCCCGCC
CCCGATCTCGTGGGACGTGCGCCGGACAGGGCACAGGAGAGCGAGACCGAGAAGGTGCTG
TGCGCGCTCTTCGCCGAGATCCTCGGCGTCGACCGGGTGGGCGTCGACGACGCCTTCCAT
GATCTCGGCGGCAGTTCGGCACTGGCCATGCGGCTCATCGCGCGGATCCGTGAGGAGCTC
GGTGCGGACCTGCCCATCCGGCAGCTGTTCTCCGCGGCCACCCCCGCGGGTGTCGCCCGG
GCGCTGGCCGCGAAGTCACGCCCCGCGCTGGAGCCCGCCGAACGGCCGGGCCGGGTACCG
CTCACCGCCCAGCAGCTCAGCGCCTGGCTGCTGGCGAGTCCCGGGGAGGCCGCCGGCCTG
CACGTCTCGGTCGCGCTGCGCTTGCGCGGCCGGCTGGACGTGCCCGCGCTGGAGGCGGCG
CTCGGCGACGTCGCGGCGCGGCACGAGATTCTCCGGACGACCTTCCCCGGCCACGCGCAG
AGCGTTCACCAGCACGTACACGACGCCTCGCCGGTTGACCTGACGCCGGTTCCCGCCACC
GAGGAGAGCCTGCCCGGGCTGCTCACCGAGCTGCGGGAGTCGGTCTTCGACCTCACCCGG
GAGGTGCCGTGGCGCGGTGACCTGTTCCGGCTCTCCGACGGGGAACACGTCCTGCACCTG
ATGGTGCACCGGATCCTCGCCGATGACGAGTCGCTGGATGTGTTCCTCCGGGACCTGTCG
GCGGCGTACGGCGCGCGGCGTGCCGGCCGGGCACCGGAGCGGGCGCCCCTGACACTGCAG
TTCGCCGACTACGCGATCTGGGAGCGGCGCCTGCTCGAAGGCGAGCGCGATGCGGACGGC
CTGATCAACGAGCAGCTGGTGTTCTGGCGCGACAATCTGGCGGGCATCCACGGGGAGACG
GTGCTCCCGTTCGACCGCCCCCGGTCGGCCGTCGCGTCGCGGCGGGCCGGCACGGTGTCG
TTGCGACTGGACGCCGGCCCGCACGCCAGGCTGGTGGAGGCGGTGGACCCGATCGGCGCG
CACCCGTTCCAGATCGTGCATGCCGCGCTCGCCATGCTGCTGACCAGGCTCGGGGCGGGC
CACGACCTGGTGATCGGCACGAAGCTGCCACGGGACGACGACCTCATCGACCTGGAGCCG
ATGATCGGGCCCTTCGCCCGGCCGCTCGCCCTGCGCACGGACCTCTCGGGCGACCCCACC
TTCCTGGAGGTCGTCACCCGGGCGCAGGAGGCGATCCGGTCCGCGCGCCAGCACCTGGAC
GTGCCCTTCGCCAGGATCGTCGAGCTGCTCGACCTGCCGGTCTCGCTCTCCCGCCATCCC
GTGTTCCAGGTGGGGTTGGAGGTGCACGAGGAGGACCTCGGCGCGTGGGACGCGACGGAG
CTGCCCGCCCTGCGCACCAGCGTCGAACCTGTCGGGCCGGAGGCCATCGAGCTGGATCTG
GCGTTCAGGCTCACCGAGCGCCGCGACGAGGACGGCATCGAGGGCACCCTCCACTATGCC
GCCGACCTCTTCGATCAGGCCACGGCCGAGTCGCTGGCACGGCGGCTGGTCAGCTTCCTG
GAGCAGGTGGCGGAGGATCCCCAGCGGCGCGTCAGCGACCTGGACGTCCTGCTGGACGAC
GCCGAACGCGAACGTCCGGCCGAGGCGCCGGCGAAGTGGTCCGAGGCCGTGCCCCCGGTG
GCCGCCGACCTGGCCGAGGGCGGTCCGCTCGGCGCGCTCGTGCTCGACGACCGGCTGCGC
CCCGCCGTCGCCGTCGGCGAGCTCTACCTCACCGGCGCGGCGGTGGACGCGGAGCCGGGC
GACCGGACCCTGGCCTGCCCCTTCGGGGCCACGGGGCGGCGCATGCTGCCCACGGGCCTG
CTCGCCCGCTGGACAGCCGGGGGCACCCTGGTCGTCGTCGGCGAGCGGCGGGGATCGAGC
GGCTCGGTGAAGACCGGCACGGGCGACTTCGAGGTGCTGCTGCCGCTGCGAGCCGGCGGT
AACCGTCCGCCGCTGTACTGCGTCCATGCGAGCGGAGGGCTGAGCTGGAACTACGCGCCC
CTGCTGCGGAGCCTGCCCCCCAACCAGCCGGTCTACGGCGTGCAGGCGCGCGGCCTGGCT
CGTACGGAGCCGCTGGCGGCCGGCGTCGAGGAGATGGCGGCCGATTACGTCGAGCAGATC
CGCGCCGTGCAGCCGACCGGGCCGTACCACCTCCTCGGGTGGTCACTGGGCGGGCGGATC
GCGCAGGAGATGGCCAGGGTGCTGGAGGAGCAAGGGGAGCAGGTCGGCCTGCTCGCCCTG
CTCGACGCCTATCCCACCGACGTGGGCAGGCTCCGGCGCCCGCGCGGCGACGCGGCCGAT
CAGGAGGCCGCGGACTTCGACAGGCAGCAGGAGCAGCAGGCGCAGCTCGCCGCCGCGGTG
GCCACGGAGGCCGGCGCCAGGAAGCGCCTGGACGAGGTCATGGAGCACCTCGCCCGGGTC
GGGCCGCTGCACACCTCCCGCAGCTTCGGCTGCGACATCCTGCTCTTCGTCGCCACAGTG
AACCGCCCCTCCCATCTGCCCGTCGCGGACGCCATCGCCAGCTGGCGACCCCTCACCACC
GGAACCGTCGAGCCTCACGAGATCGAGATCGACCACATGCAGATGCTGCAGCCCGCGGCG
CTGGCCCGGATCGGGGCCGTCGTCGCCGAGAAACTCCGGCCCCGGCCGGACGGTGAAAGG
ACACAGCGATGA
[7] C15..310
[7] A494..894
[7] L-3,5-dihydroxyphenylglycine(Dpg)660..760
[7] PCP976..1043
[7] X1057..1355
[7] TE1624..1841
[7] C43..930
[7] A1480..2682
[7] L-3,5-dihydroxyphenylglycine(Dpg)1978..2280
[7] PCP2926..3129
[7] X3169..4065
[7] TE4870..5523

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [494-894]  1e-107 PF00501
PF00501   AMP-binding
IPR001031 Thioesterase (Domain)
 [1624-1841]  3.99999999999998e-40 PF00975
PF00975   Thioesterase
IPR001242 Condensation domain (Domain)
 [15-310]  8.00000000000001e-63 PF00668 [1057-1355]  1.29999999999998e-42 PF00668
PF00668   Condensation
IPR009081 Acyl carrier protein-like (Domain)
 [976-1043]  PS50075
PS50075   ACP_DOMAIN
 [967-1046]  1.69999999999999e-25 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [968-1060]  3.89999861795218e-19 SSF47336
SSF47336   ACP_like
 [979-1042]  1.3e-12 PF00550
PF00550   PP-binding
IPR010071 Amino acid adenylation domain (Domain)
 [494-894]  6.10000000000004e-129 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [614-625]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit