close all open/close all

CDS information : A4092_00230


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction42,731 / 30,480 / - [in whole cluster]
42,731 / 30,480 / - [in contig]
Locationcomplement(30480..42731) [in whole cluster]
complement(30480..42731) [in contig]
TypeCDS
Length12,252 bp (4,083 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative non-ribosomal peptide synthetase, modules 4-6
Gene
Gene (GenBank)dbv17
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionPKS/NRPS Module

A4 L-4-hydroxyphenylglycine(Hpg)
5 L-4-hydroxyphenylglycine(Hpg)
6 tyrosine
C7..301
A482..879
PCP957..1023
E1060..1493
C1502..1792
A1972..2371
PCP2454..2520
E2566..3006
C3018..3309
A3492..3886
PCP3980..4046

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, modules 4-6]
MAQSRIEDFWPLSPLQQGLLFHTTYDDDWPGLYVGHWILNLNGPVEADRLRAAWEALLAR
HAALRACFRQRKSGETVQLIARQVELPWRVVDLSHLSEPEEAVRAVAEEDRTRRFDLAKA
PLLRLTLIRLAGDDHRLVMTCHHAIMDGWSMPIMLDELSMLYAADGSPLDLPAVPSYRDY
LVWLDRQDKERTLSAWAAELRGVEEPTLVAPADANRAPAMPENITVELPEDLTRALSELA
RTHGLTLNTVVQGAWALLLAQLAGRTDVVFGAAVSARPPDLPGVEGMVGLFLNTVPVRVR
LSGSTPVIEFLADLQKRQSALIPHQYMGLADIQRTAGAGAVFDTLLVFQNFPRELRPSDA
AAAFDIRIDQGREAAHYPLTLVAVPGESMLLNLDHVTDLFDREAALAILERFTGILRQLA
GAGDLTVAEVDVTSAAERALVVNAWSAAPRVAPGELAPDLFDRQVERGRDRVAVVEGKRA
VSFGELAEHAERLAGYLSGRGVRRGDRVAVVMGRSPGLIATLLAVWKAGAAFVPVDPAYP
AERVQFMLADAEPAAVVTERACQAAVPAGGLDPIVLDDPDTLRAVAEHARLSAGAHADDL
AYVMYTSGSTGRPKGVAVSHGNVAALAGEPGWGLGPEDAVLMHASHAFDISLFELWVPLL
SGARVVLAEPGAVDGEALAGYVAGGVTCAHLTAGTFRVLAEESPESVAGLREVLTGGDAV
PLAAVERVRRACPDVRVRHLYGPTEATLCATWWLLQPGEPTGPVLPIGRPLAGRRVYVLD
AFLRPVPPGVTGELYVAGAGVAQGYLGRPALTAERFVAEPFVPGGRMYRTGDLARWTDQG
ELAFAGRADDQVKIRGYRVEPGEIEAVLAGLPGVGQAVVSAREERLIGYVVAETGGDLDP
VRIREQLAATLPEFMVPAAVLVLDALPLTGNGKVDRRALPEPDFAAGAVDREPATDAERI
LCGVFAEVLGAGRVGVADSFFELGGDSISSMQVAARARRQGIPLTPRQVFEHRTPERLAA
LAQQAPGRRASSVEPGVGEIPRTPVMRALGDDAVRPGFAQARVVVTPAGFAPDALVTALQ
AVLDVHDLLRTRVEPDGRLMVAEPGAVDAAGLVTRVAAGNGNLAERAEREARTAAGTLDP
SEGIMVRAVWVDAGDAEPGRLALVVHHLVVDAVSWAILLSDLRAAYDEAVSGGTPVLEPA
VTSYRQWARRLAGQALSESTVAEAGHWAGVLEGGDLPLERHPGQSASWSRTLSDAQARNL
VARVPAAFHCGVQDVLLAGLAGAVARWRGADAGILVDVEGHGRHAADGEDLLRTVGWFTS
VHPVRLDVSGVGPGAAAAGELLKAVKEQARAVPGDGLGYGLLRYLNPETGARLAELPSAQ
IGFNYLGRSGVASEDTAWQVCEGALGGQAAGPDLVQSHALEVGADVQDTPAGPRLRLAID
GRDLDPAAVERLGEAWLDTLAGLAALADTPGAGGHTPSDFELVEVRQRDVDELEAVAPGL
TDVWPLSPLQEGILFERAFDEDGVDVYQTQRILDLDGPLDAQRLHAAWQSVIDRHETLRT
GFHQLGSGETVQVVVGEAEVLWREADLSRLDEPDAEVERLLAADQAERFDVSRAPLLRLL
LIRLGAARHRLVVTSHHVLVDGWSTPILLGEMLTAYADGRVSPAPPSYRDYVAWLSRQDE
DAARSAWRAELAGLDEPTVVGLDAGKAPVMPDGHAEWLSEEATRALTGFARGHGLTLSTV
VQGAWALVLARLARRTDVVFGTVVSGRPADALPDVERMVGMFINTVPVRVRLDGAVPVLD
LLQDLQRRQSSLTEHQHLGLPEIQKAAGPGSIFDTILMIVNYPLDADGLDDGGVAISSIR
TRTGTTYPLSVSVIPGARLQIQLDYRPDWIGGDLAAEITGQVVRVLARMVAEPSLPVGRL
AVTSRSTRGSVTERWNSTGAAAGGSSVPELFRRQADAAPDATAVIGDGRTLSYAGLDRES
DRLAGHLARRGVRRGDRVGVLMERGADLIVALLAVWKAGAAQVPVNVDYPAERIERMLAD
AGASVAVCAGATRHAVPDGIEPVVMDAPATEAERHEAPPLAVGAHDVAYVMYTSGSTGVP
KGVAVPHGSAAALAGDPGWSQGAGDRVLMHASHAFDASLLEIWVPLVSGACVMVAEPGAI
DAQRLRDVIARGATTVHLTAGTFRVLAEESPDSFSGLREVLTGGDVVPLESVARVRRACP
EVRVRELYGPTEVTLCATWHLIEPHTETGDTLPIGRPLAGRQVYVLDAFLQPVAPNVTGE
LYLAGAGLAHGYLGAPAATSERFIAVPASVNPAASGERMYRTGDLARWTDRGELLFAGRA
DSQVKIRGYRVEPGEIEAALAEVPHVAQAVVVAREDRPGEKRLIAYVTAEEGSGLDPDAV
REHLAGRLPEFMVPAAVVLLDGVPLTPNGKIDRAALPVPEFTGKAAGREPRTEAERVLCE
LFAEVLGVARAGAEDSFFELGGDSILSMRLAARARREELVFGAKDVFERKTPAGIAMVAE
RGGATRASLDDGVGEVMSTPVIRALLERDPDAMTRGALSQWVTAGAPDDLSVDVLAAGLG
AVIDAHDMLRSRIVRTGAAQPRLVVAGRGAVDAATLVERVEAGTGDVDEIADRCARDAAA
RLDPHAGVMIRAVWVDAGPGRVGRLVVAAHHLVVDVVSWRILLPDLQVACEAVAAGRRPV
LDPVDVSFRRWARTLADQAVTRATELETWTEILDGARSRLGELDPARDTVSTAGRTSWTL
PHDRAGVLVEQATSAFHCGVHEVLLATLAGAVAHWRGGTAVVVDVEGHGRRPIDELDLSR
TVGWFTDVHPLRLDVTGIDPAEVIAGGGAAGHLLKQVKENVRAVPDGGLGYGILRYLNAG
TGQALAAAPKPEIGFNYLGRFPSRSAGAPEPWQLLGTIGGTAEQDTALRHAVEIDAAVLD
GAAGPELSLTVTWAGRLLGEAEAESLAQAWLAMLTGLAAHVGGGGAGGHTPSDFPLISLT
QQDVAEVEAAVPTLLDIWPLSPLQEGLLFHAADERGPDVYAGMRKLALDGPLDVARFRAS
WQALLDRHPALRASFHQLGSGAAVQAIAREVPLDWQETDLSRLPEDEALAEFDRLAEQLH
TERFDLTRAPQLRLHLVRLGERRHRLVLTSHHIVADGWSLPLITEDVLTVYESGGDGRAL
PAATSYRDYLAWIARQDKAAAREAWRAELAGLDEATHVVPPETITTPLEPERVGFELDEA
LSRRVVEFTGRHGVTANTLFQGIWALHLARLTGRDDVVFGAAVAGRPPEIPGVESAVGLF
MNMLPVRARLAGAEPFLDMLTDLQERQVACMPHQHVGLSEINQLAGPGAAFDTIVVFENY
PPPPPRPEGPDALVMRPAGIPNDTGHYPLSMRASVAGRVHGEFIYRPDVVDRAEAEEMLA
SILRALEQVVAEPRVPVGRVGLIGPEQRRLVVEEWNRTGVPPAAEPVPMLFRRQVERSPD
AVAVVDAARSLSYSGLLDEAEELARLLVGLGVRRETRVGVLVGRSAELVVALLGVSSAGG
VFVPMDPDYPRERISFILADSAPEVLLCTSETRQAVPEEFAGAVVALDAPLAADPRTALP
RVEAGDGAYVIYTSGSTGVPKGVLVPHAGLGNLASAQIERFGVTSASRILQFAALGFDAA
VSELCMALLSGGTVVLADAESMPPRVSLGDAVRRWGITHVTVPPSVPAVEDDLPDSLETL
VVAGEACPPALVDRWSPGRRMINAYGPTETTVCATMSSPLSPGRDVVPIGRPITGLRAYV
LDAFLQPVPPGVTGELYVAGAGLARGYLGRPGLTAERFVAVPASVSPARPGERMYRTGNR
ARWTRDGELVFTGRADAQVKVRGYRIEPGEIEAVLADHPGVAQVAVVAREDGPGQKYLVA
YVVPAAEQVAGAPSEAGQDGALISALRESAAGRLPEHMRPAAFVPLDTMPLTPNGKVDHR
ALRAPDFARSSSGRDPRSAMEAKLCELFAEVLGLEEVGAGDSFFELGGDSITSMQLSALA
RRKGLDLTPWQVFDEKTAERLAAVVKELPADGEGTGEPEPPAGTLVDLSPDQLDQLEAGP
AGG
selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase, modules 4-6]
ATGGCTCAGTCGCGGATCGAAGATTTCTGGCCGCTGTCACCACTCCAGCAAGGGTTGCTC
TTCCACACGACCTATGACGACGACTGGCCCGGCCTTTATGTGGGCCATTGGATCCTGAAC
CTGAACGGTCCGGTGGAAGCGGACAGACTGCGTGCCGCATGGGAGGCGCTCCTGGCGCGG
CACGCCGCTCTCCGGGCTTGTTTTCGGCAGCGCAAATCAGGTGAGACGGTGCAGCTCATC
GCCAGGCAGGTGGAGCTGCCGTGGCGGGTGGTGGACCTCTCCCACCTCAGCGAGCCCGAG
GAGGCCGTGCGCGCGGTGGCCGAGGAGGACAGGACGCGGAGGTTCGACCTCGCGAAGGCG
CCGTTGCTGCGGCTGACCCTGATCCGTCTCGCCGGCGACGACCACCGCCTGGTGATGACC
TGCCACCACGCGATCATGGATGGCTGGTCGATGCCCATCATGCTCGACGAGCTGTCGATG
CTGTACGCGGCCGACGGGAGCCCGCTGGACCTGCCCGCGGTGCCGTCGTACCGGGATTAC
CTGGTGTGGCTGGACCGGCAGGACAAGGAGCGCACGCTGTCGGCATGGGCGGCGGAGCTG
CGGGGTGTCGAGGAGCCGACGCTGGTGGCGCCCGCCGATGCGAACCGGGCGCCCGCCATG
CCGGAGAACATCACGGTCGAGCTGCCCGAGGACCTCACGCGAGCCCTGAGCGAGCTGGCT
CGCACCCATGGGCTGACGCTGAACACAGTGGTGCAGGGCGCGTGGGCGTTGCTGCTCGCC
CAGCTCGCGGGCCGGACGGACGTGGTGTTCGGTGCGGCGGTCTCGGCACGCCCGCCGGAT
CTGCCCGGCGTCGAGGGGATGGTGGGGTTGTTCCTCAACACCGTCCCCGTACGCGTGCGG
CTGAGCGGTTCGACGCCGGTCATCGAATTCCTGGCGGATTTGCAGAAGCGGCAGTCGGCG
CTCATCCCCCACCAGTACATGGGATTGGCGGATATTCAGAGGACGGCCGGCGCCGGCGCC
GTCTTCGACACCTTGCTCGTTTTCCAGAACTTTCCCCGTGAGCTTCGCCCATCGGATGCC
GCGGCAGCCTTCGATATTCGAATAGACCAGGGCCGGGAAGCCGCCCATTATCCGCTGACG
CTGGTCGCCGTCCCCGGCGAGTCGATGCTGCTCAATCTCGACCATGTGACGGACCTCTTC
GACCGGGAAGCCGCGCTCGCCATCCTGGAGCGATTCACCGGGATTCTGCGGCAGCTGGCG
GGCGCGGGCGACCTCACGGTGGCCGAGGTCGACGTGACGAGTGCGGCCGAGCGTGCGCTG
GTGGTGAACGCATGGAGTGCGGCACCCCGCGTGGCGCCGGGCGAGCTGGCTCCGGATCTC
TTCGACCGCCAGGTGGAGCGCGGCCGTGACCGGGTGGCGGTCGTCGAGGGGAAGCGGGCG
GTCTCGTTCGGTGAGCTGGCCGAGCACGCGGAGAGGCTCGCCGGCTACCTGAGCGGCCGG
GGCGTCCGGCGCGGGGATCGGGTGGCCGTGGTGATGGGCCGGTCACCCGGCCTGATCGCG
ACGCTGCTGGCGGTGTGGAAGGCGGGAGCGGCGTTCGTGCCGGTGGATCCCGCCTACCCG
GCGGAGCGCGTGCAGTTCATGCTCGCGGACGCGGAGCCGGCGGCAGTGGTGACCGAGCGA
GCGTGCCAGGCCGCCGTGCCGGCCGGCGGGCTCGATCCGATCGTCCTGGACGACCCGGAC
ACGCTGCGGGCGGTGGCGGAGCACGCCCGTCTCTCCGCGGGTGCGCACGCGGACGACCTC
GCGTACGTGATGTACACGTCGGGATCGACGGGCAGGCCGAAGGGCGTCGCGGTCTCGCAC
GGCAACGTCGCGGCGCTGGCCGGCGAGCCGGGATGGGGGCTGGGGCCCGAGGACGCCGTG
CTGATGCACGCCTCGCACGCGTTCGACATCTCGCTGTTCGAGCTGTGGGTGCCGCTGCTG
TCGGGCGCCCGGGTCGTGCTCGCCGAGCCGGGCGCGGTGGACGGCGAGGCCCTGGCCGGG
TACGTGGCCGGCGGTGTCACCTGCGCTCACCTGACGGCGGGGACCTTCCGGGTGCTGGCC
GAGGAGTCACCGGAGTCGGTCGCCGGGCTGCGCGAGGTGCTGACCGGTGGGGACGCGGTG
CCGCTCGCGGCGGTGGAACGGGTGCGGCGGGCGTGCCCGGACGTCCGCGTGCGGCATCTC
TACGGCCCGACGGAGGCCACGCTGTGTGCGACATGGTGGCTGCTGCAGCCGGGCGAGCCG
ACGGGGCCGGTGCTGCCGATCGGGCGTCCGCTCGCGGGGCGGCGGGTCTATGTCCTCGAC
GCGTTCCTGCGGCCCGTGCCCCCGGGGGTGACGGGCGAGCTGTACGTCGCCGGGGCCGGG
GTGGCGCAGGGCTATCTGGGCCGCCCGGCGTTGACGGCCGAGCGGTTCGTCGCCGAGCCG
TTCGTGCCCGGTGGGCGGATGTACCGGACCGGAGACCTGGCGCGCTGGACGGATCAGGGT
GAGCTGGCGTTCGCCGGGCGTGCCGACGACCAGGTGAAGATCCGCGGGTACCGGGTGGAG
CCCGGCGAGATCGAGGCGGTCCTCGCCGGCCTTCCAGGTGTCGGTCAGGCCGTGGTGTCC
GCGCGGGAAGAGCGCCTGATCGGTTACGTGGTCGCCGAAACAGGGGGGGACCTCGACCCG
GTGCGGATACGCGAGCAGCTCGCCGCGACGCTGCCCGAGTTCATGGTTCCGGCCGCGGTG
CTGGTGCTGGACGCGTTGCCGCTGACCGGCAACGGAAAGGTGGACCGCCGGGCCCTGCCC
GAGCCGGACTTCGCTGCCGGGGCGGTGGACCGGGAGCCGGCCACCGACGCCGAGCGGATC
CTGTGCGGAGTGTTCGCCGAGGTCCTGGGGGCGGGGCGGGTCGGGGTCGCAGACAGCTTC
TTCGAGCTGGGCGGGGACTCGATCTCGTCGATGCAGGTCGCCGCCCGCGCGCGGCGCCAG
GGTATCCCGCTGACCCCCCGACAGGTGTTCGAGCACCGCACGCCCGAGCGGCTGGCGGCG
CTGGCTCAACAGGCCCCGGGGAGGCGAGCCTCCTCAGTGGAGCCGGGCGTGGGCGAGATC
CCGAGGACGCCGGTGATGCGTGCCCTCGGCGATGACGCGGTGCGCCCCGGTTTCGCGCAG
GCGCGGGTCGTCGTCACCCCGGCCGGCTTCGCCCCGGACGCGCTGGTGACCGCCCTGCAG
GCCGTCCTGGATGTGCACGATCTGCTACGGACGCGGGTGGAGCCCGACGGACGGCTGATG
GTGGCCGAGCCGGGTGCCGTGGACGCGGCCGGCCTGGTGACGCGGGTGGCGGCCGGGAAC
GGGAACCTCGCTGAGCGCGCCGAGCGCGAGGCCAGGACGGCGGCGGGCACGCTGGACCCG
TCCGAAGGGATCATGGTCCGGGCCGTGTGGGTCGACGCGGGCGACGCCGAGCCGGGCCGG
TTGGCCTTGGTGGTGCATCACCTGGTCGTCGACGCGGTCTCGTGGGCGATCCTGCTGTCG
GATCTGCGGGCGGCCTACGACGAGGCGGTCTCCGGCGGAACCCCCGTCCTCGAACCCGCG
GTGACGTCGTACCGGCAATGGGCGCGGCGGCTGGCCGGGCAGGCGCTCAGCGAGAGCACC
GTGGCCGAGGCCGGCCATTGGGCCGGCGTGCTCGAAGGCGGCGACCTGCCGCTGGAGCGG
CACCCCGGGCAGTCGGCGTCGTGGTCGCGGACACTGTCCGATGCCCAAGCGCGCAACCTG
GTGGCGCGCGTGCCGGCAGCCTTCCACTGCGGGGTTCAGGACGTCCTGCTGGCGGGCCTG
GCGGGTGCGGTGGCGCGGTGGCGCGGTGCTGACGCCGGGATCCTGGTGGACGTGGAAGGC
CACGGCCGCCATGCCGCCGACGGAGAGGATCTGCTGCGTACCGTGGGCTGGTTCACCAGC
GTTCATCCGGTCCGCCTCGATGTCTCCGGTGTCGGTCCAGGAGCTGCGGCGGCCGGGGAG
TTGCTGAAGGCCGTGAAGGAACAGGCGCGAGCGGTGCCGGGCGACGGGCTCGGCTACGGG
CTGTTGCGCTACCTCAACCCCGAAACCGGCGCCCGGCTGGCGGAGCTGCCGTCGGCCCAG
ATCGGATTCAACTATCTCGGACGGTCCGGCGTCGCCTCCGAGGACACCGCGTGGCAGGTG
TGCGAAGGGGCTCTCGGCGGACAGGCGGCCGGGCCGGACCTCGTCCAGTCCCACGCCCTG
GAGGTCGGCGCGGACGTTCAGGACACGCCGGCCGGCCCCCGGCTGAGACTCGCCATCGAC
GGCAGGGACCTCGACCCTGCCGCGGTGGAGCGGCTCGGCGAGGCGTGGCTGGACACGCTG
GCCGGCCTCGCCGCTCTCGCCGACACTCCCGGCGCGGGCGGACACACACCGTCCGACTTC
GAGCTGGTCGAGGTGCGGCAGCGGGACGTGGACGAACTGGAGGCCGTGGCGCCCGGCCTG
ACGGACGTCTGGCCACTGTCGCCGCTCCAGGAGGGCATCCTCTTCGAGAGAGCCTTCGAC
GAGGACGGCGTCGACGTCTACCAGACCCAGCGGATCCTGGACCTCGACGGGCCGCTCGAC
GCGCAACGGCTGCACGCGGCGTGGCAGTCGGTGATCGACCGGCACGAGACGCTCCGGACG
GGCTTCCACCAGCTGGGATCCGGCGAGACGGTGCAGGTCGTCGTGGGCGAGGCCGAGGTC
CTGTGGCGTGAGGCGGACCTGTCGCGGCTCGATGAGCCGGACGCGGAGGTGGAACGCCTG
CTCGCGGCGGATCAGGCGGAGCGGTTCGACGTCAGCAGGGCGCCGCTGCTGCGGTTGCTG
CTGATCCGTCTCGGTGCGGCGCGGCACCGGCTCGTGGTGACGTCGCACCATGTGCTCGTG
GACGGCTGGTCCACGCCGATCCTGCTGGGCGAGATGCTGACCGCCTACGCCGACGGACGG
GTCTCGCCGGCGCCGCCCTCCTACCGGGACTACGTGGCGTGGCTGAGCCGTCAGGACGAG
GACGCGGCACGATCGGCGTGGCGGGCCGAGCTCGCCGGGCTGGACGAACCGACCGTGGTG
GGCCTCGACGCGGGCAAGGCGCCGGTGATGCCGGACGGGCATGCCGAATGGCTGTCCGAG
GAGGCGACCCGCGCCCTCACCGGCTTCGCCCGTGGTCATGGGCTGACGTTGAGCACGGTC
GTGCAGGGCGCCTGGGCCCTGGTGCTGGCGCGGCTGGCGAGACGGACGGATGTGGTGTTC
GGCACGGTCGTGTCCGGGCGTCCGGCGGACGCGTTGCCGGATGTCGAGCGGATGGTGGGG
ATGTTCATCAACACCGTTCCGGTCCGGGTGCGCCTCGACGGGGCTGTTCCGGTGCTGGAC
CTGCTCCAGGACCTGCAGCGGCGCCAGTCGTCCTTGACGGAGCATCAGCACCTGGGGCTG
CCGGAGATCCAGAAGGCGGCGGGGCCGGGCTCGATCTTCGACACGATCCTGATGATCGTC
AACTACCCGCTGGACGCCGACGGTCTCGACGACGGTGGCGTGGCGATCAGCTCGATCCGC
ACGCGGACCGGCACCACCTATCCGCTGTCCGTGAGCGTCATCCCGGGCGCGCGCCTGCAG
ATCCAGCTGGACTACCGGCCCGACTGGATCGGCGGGGACCTGGCCGCCGAGATCACCGGG
CAGGTCGTGCGGGTCCTGGCCCGGATGGTGGCGGAGCCCTCGCTTCCCGTCGGCCGCCTG
GCCGTGACCAGCCGATCCACCCGCGGCTCCGTGACGGAGCGCTGGAACTCGACCGGTGCG
GCGGCCGGCGGTTCATCGGTGCCGGAGCTGTTCCGGCGCCAGGCCGACGCGGCGCCGGAC
GCGACGGCGGTCATCGGCGACGGACGCACCCTGTCCTACGCCGGCCTCGACCGGGAATCG
GACCGGCTGGCGGGGCACCTGGCCAGGAGGGGCGTGCGGCGCGGCGACCGCGTCGGCGTG
CTGATGGAACGCGGCGCGGACCTGATCGTCGCCCTGCTCGCGGTCTGGAAGGCGGGGGCC
GCGCAAGTCCCGGTGAACGTGGACTACCCGGCGGAGCGCATCGAGCGGATGCTGGCCGAC
GCCGGCGCGTCGGTGGCGGTGTGCGCGGGAGCGACCCGGCACGCGGTCCCGGACGGGATC
GAGCCGGTGGTCATGGACGCACCCGCGACCGAGGCGGAGCGGCACGAGGCGCCACCGCTC
GCGGTCGGAGCGCATGACGTGGCCTACGTGATGTACACGTCCGGATCGACCGGGGTGCCG
AAGGGCGTCGCGGTGCCGCATGGGAGCGCCGCGGCTCTGGCCGGCGACCCGGGCTGGTCG
CAGGGCGCCGGCGACCGCGTGTTGATGCACGCGTCGCACGCGTTCGACGCGTCGCTGCTC
GAGATCTGGGTGCCGCTGGTCAGCGGAGCCTGCGTGATGGTCGCGGAACCGGGCGCGATC
GACGCGCAGCGGCTGCGGGACGTGATCGCACGGGGCGCGACCACCGTCCATCTGACGGCG
GGGACCTTCCGGGTGCTGGCGGAGGAGTCGCCGGACTCCTTCAGCGGGCTGCGCGAGGTC
CTCACCGGCGGGGACGTGGTGCCGCTCGAGTCCGTCGCACGGGTGCGCCGGGCATGCCCG
GAGGTCCGGGTCCGGGAGTTGTACGGCCCCACCGAGGTCACGCTCTGCGCCACCTGGCAC
CTCATCGAGCCGCACACGGAAACGGGCGACACCTTGCCCATCGGCCGTCCGCTGGCCGGC
CGGCAGGTGTACGTCCTGGATGCCTTCCTCCAGCCGGTGGCGCCGAACGTCACCGGTGAG
CTCTACCTCGCCGGCGCGGGCCTGGCACACGGTTACCTGGGCGCCCCCGCGGCGACCTCG
GAGCGGTTCATCGCGGTGCCCGCTTCGGTGAACCCCGCGGCCTCCGGTGAGCGGATGTAC
CGCACCGGCGACCTGGCGCGCTGGACGGACCGAGGCGAGCTGCTGTTCGCCGGGCGGGCC
GACTCCCAGGTGAAGATCCGGGGCTACCGCGTCGAGCCAGGGGAGATCGAGGCGGCGCTG
GCCGAGGTTCCGCACGTCGCGCAGGCGGTCGTCGTGGCGCGGGAGGACCGTCCCGGCGAG
AAGAGACTCATCGCCTACGTGACCGCGGAGGAGGGCTCGGGCCTGGATCCCGACGCGGTA
CGCGAGCACCTCGCGGGACGGCTGCCGGAGTTCATGGTGCCGGCGGCGGTGGTGCTGCTG
GACGGCGTCCCGCTGACGCCCAACGGGAAGATCGACCGTGCCGCGCTGCCCGTCCCCGAG
TTCACCGGGAAGGCGGCCGGCCGGGAGCCGCGTACCGAGGCCGAGCGGGTGTTGTGCGAA
CTGTTCGCCGAGGTCCTGGGCGTGGCGCGAGCCGGAGCCGAGGACAGCTTCTTCGAGCTG
GGCGGCGACTCGATCCTCTCCATGCGGTTGGCCGCCCGCGCGCGACGTGAGGAGCTCGTC
TTCGGCGCGAAGGACGTCTTCGAGCGCAAGACGCCCGCCGGGATCGCGATGGTCGCCGAA
CGCGGCGGTGCGACGCGGGCGAGCCTCGACGACGGCGTCGGTGAGGTGATGTCGACGCCG
GTGATCCGGGCACTGCTCGAACGCGATCCCGACGCGATGACCCGGGGCGCCCTGTCCCAG
TGGGTGACCGCCGGTGCGCCCGACGACCTGTCGGTGGACGTGCTGGCGGCCGGATTGGGC
GCGGTCATCGACGCGCATGACATGCTGCGCAGCCGGATCGTCCGCACCGGGGCTGCGCAG
CCCCGGCTGGTCGTGGCCGGCCGCGGAGCGGTGGACGCGGCGACGCTGGTCGAACGGGTC
GAGGCCGGCACCGGTGACGTGGATGAGATCGCGGATCGCTGCGCCCGCGACGCGGCCGCA
CGGCTGGATCCCCACGCCGGCGTGATGATCCGGGCGGTCTGGGTGGACGCGGGGCCAGGG
CGGGTGGGACGGCTCGTCGTGGCGGCGCACCATCTCGTGGTGGACGTCGTGTCGTGGCGA
ATCCTGCTGCCGGACCTGCAGGTGGCCTGCGAAGCCGTGGCCGCCGGCCGGCGGCCGGTG
CTCGACCCCGTCGACGTCTCGTTCCGGCGCTGGGCGCGAACGCTGGCCGATCAGGCGGTG
ACACGGGCCACGGAGCTGGAGACGTGGACGGAGATCCTCGACGGGGCGCGATCGCGGCTG
GGCGAGCTCGACCCGGCGCGCGACACCGTCTCGACCGCGGGACGCACATCGTGGACGCTG
CCGCATGACCGGGCGGGCGTGCTCGTGGAGCAGGCCACCTCCGCCTTCCACTGCGGTGTC
CACGAGGTGTTGCTGGCGACGCTGGCAGGCGCGGTGGCCCACTGGCGCGGCGGCACCGCG
GTCGTGGTGGACGTCGAAGGTCACGGCCGCCGGCCCATCGACGAGCTGGACCTGTCGCGG
ACGGTCGGCTGGTTCACCGACGTGCATCCGCTCCGGCTGGATGTGACAGGGATCGATCCG
GCCGAAGTGATCGCGGGTGGCGGTGCGGCCGGTCACCTGCTGAAGCAGGTCAAGGAGAAC
GTGCGGGCCGTGCCCGACGGCGGGCTCGGCTACGGGATCCTGCGCTATCTCAACGCCGGG
ACGGGGCAGGCTCTCGCGGCGGCGCCGAAGCCGGAGATCGGGTTCAACTACCTCGGCCGC
TTCCCGTCCCGGTCCGCGGGCGCCCCGGAGCCCTGGCAGCTGCTGGGCACCATCGGCGGC
ACGGCGGAGCAGGACACGGCGTTGCGGCACGCCGTGGAGATCGACGCGGCCGTGCTGGAC
GGTGCGGCAGGACCTGAGCTGAGCCTGACCGTGACCTGGGCGGGGCGGCTGCTCGGCGAG
GCCGAGGCGGAGTCGCTCGCGCAGGCCTGGCTGGCCATGCTGACCGGCCTTGCGGCACAC
GTCGGTGGCGGCGGCGCCGGCGGGCACACGCCGTCGGACTTCCCGCTCATCTCGCTGACG
CAGCAGGACGTGGCGGAGGTCGAGGCCGCCGTACCGACCCTGCTCGACATCTGGCCGCTG
TCTCCGCTCCAGGAGGGCCTGCTGTTCCACGCCGCCGACGAGCGCGGCCCGGACGTCTAC
GCGGGGATGCGCAAGCTCGCCCTCGACGGTCCGTTGGACGTCGCCCGGTTCCGCGCCTCC
TGGCAGGCTCTGCTCGACCGGCACCCCGCCCTGCGGGCGAGCTTCCACCAGCTCGGGTCC
GGCGCGGCCGTGCAGGCGATCGCTCGCGAGGTGCCGCTGGACTGGCAGGAGACCGATCTG
TCCCGGCTGCCCGAGGACGAGGCGCTGGCGGAGTTCGACCGCCTCGCGGAGCAGCTGCAC
ACCGAGCGGTTCGACCTGACCCGGGCGCCGCAGCTGCGGCTGCACCTGGTGCGCCTCGGC
GAACGCCGGCACCGGCTGGTCCTGACCTCGCATCACATCGTGGCCGACGGCTGGTCCCTG
CCGCTGATCACCGAGGACGTGCTGACCGTGTACGAGTCCGGCGGTGACGGCCGGGCCCTT
CCGGCCGCGACGTCGTACCGCGACTATCTCGCCTGGATCGCCCGCCAGGACAAGGCGGCC
GCCCGAGAGGCGTGGCGGGCCGAGCTGGCGGGGCTCGACGAGGCGACCCACGTCGTGCCG
CCGGAGACGATCACCACTCCCCTGGAGCCCGAACGTGTCGGGTTCGAACTCGACGAGGCG
CTGAGCCGGCGCGTGGTGGAGTTCACCGGTCGTCACGGCGTGACGGCGAACACGCTCTTC
CAGGGGATCTGGGCACTGCACCTGGCCCGGCTGACCGGACGCGACGACGTGGTCTTCGGC
GCCGCGGTGGCCGGGCGCCCGCCCGAGATCCCCGGTGTGGAGTCCGCCGTCGGCCTGTTC
ATGAACATGTTGCCGGTCCGGGCTCGCCTGGCCGGTGCGGAGCCGTTCCTCGACATGCTG
ACAGACCTTCAGGAACGGCAGGTCGCGTGCATGCCGCACCAGCACGTGGGGCTGAGCGAG
ATCAACCAGCTCGCCGGTCCGGGCGCGGCGTTCGACACGATCGTGGTGTTCGAGAACTAC
CCGCCCCCGCCGCCTCGGCCCGAAGGCCCCGACGCGCTCGTCATGCGGCCCGCGGGCATC
CCGAACGACACAGGGCACTATCCGCTGTCCATGCGCGCGTCCGTGGCGGGCCGCGTCCAC
GGTGAGTTCATCTACCGGCCGGACGTGGTCGATCGGGCCGAGGCCGAGGAGATGCTCGCG
TCGATCCTCCGGGCACTGGAGCAGGTGGTGGCCGAGCCGCGCGTGCCGGTCGGGCGCGTG
GGCCTGATCGGTCCTGAGCAGCGCCGCCTGGTGGTGGAGGAGTGGAACAGGACCGGCGTG
CCGCCCGCCGCGGAGCCGGTGCCGATGCTGTTCCGCCGGCAGGTGGAGCGCTCGCCGGAT
GCGGTGGCGGTGGTGGACGCGGCCCGGAGCCTGTCGTACAGCGGACTGCTGGACGAGGCG
GAGGAGCTGGCGCGGCTGCTGGTGGGGCTGGGCGTGCGCCGTGAGACGCGGGTGGGCGTG
CTCGTGGGACGCTCGGCCGAGCTGGTGGTGGCACTGCTCGGGGTGTCCTCGGCGGGCGGG
GTGTTCGTCCCGATGGATCCCGATTATCCGCGCGAGCGCATCAGCTTCATCCTGGCGGAT
TCCGCGCCGGAGGTGCTGCTGTGCACGAGCGAGACCAGGCAGGCCGTCCCGGAGGAGTTC
GCGGGCGCGGTGGTGGCGCTGGACGCGCCGCTCGCCGCCGATCCGCGCACTGCGCTGCCC
CGGGTGGAGGCGGGTGACGGGGCGTATGTGATCTACACCTCGGGGTCGACGGGCGTGCCC
AAGGGAGTCCTCGTCCCCCATGCCGGGCTCGGCAATCTGGCGAGCGCGCAGATCGAGCGC
TTCGGCGTCACGTCCGCCTCGCGGATCCTGCAGTTCGCCGCTCTCGGCTTCGACGCCGCC
GTCTCCGAGCTGTGCATGGCCCTGTTGTCGGGCGGGACCGTGGTGCTGGCCGACGCGGAG
AGCATGCCGCCCCGGGTGTCGCTGGGCGACGCGGTACGCCGGTGGGGCATCACCCACGTG
ACCGTGCCGCCGAGCGTGCCGGCCGTCGAGGACGACCTGCCGGACAGCCTGGAGACCCTG
GTCGTGGCCGGCGAGGCCTGCCCGCCCGCGCTGGTGGACCGCTGGTCGCCGGGCCGCCGG
ATGATCAACGCCTACGGGCCCACCGAGACGACCGTCTGCGCGACGATGAGCTCCCCGCTG
TCTCCGGGACGCGACGTGGTGCCCATCGGCCGGCCGATCACCGGCCTGCGAGCCTATGTG
CTCGACGCCTTCCTGCAGCCCGTGCCGCCAGGTGTGACCGGCGAGCTCTATGTGGCGGGG
GCCGGGCTCGCCCGCGGCTACCTCGGCCGTCCGGGCCTGACAGCGGAGCGGTTCGTCGCG
GTGCCGGCCTCGGTGAGCCCTGCCCGTCCTGGTGAGCGCATGTACCGCACCGGCAACCGG
GCCCGCTGGACCCGGGACGGTGAGCTGGTCTTCACCGGCCGGGCCGACGCGCAGGTCAAG
GTGCGCGGCTATCGGATCGAGCCGGGTGAGATCGAGGCCGTGCTGGCGGACCATCCGGGG
GTCGCCCAGGTGGCGGTCGTCGCCCGCGAGGACGGTCCGGGCCAGAAGTACCTGGTGGCG
TATGTCGTCCCCGCGGCCGAGCAGGTGGCCGGCGCTCCCTCCGAGGCCGGGCAGGACGGC
GCGTTGATCTCCGCCCTCCGCGAGAGCGCGGCCGGACGCCTGCCGGAGCACATGAGGCCG
GCGGCGTTCGTCCCGCTGGACACGATGCCCCTGACCCCGAACGGCAAGGTCGATCATCGG
GCGCTGCGGGCCCCCGATTTCGCGAGGTCGTCGTCAGGACGCGACCCGCGCTCGGCCATG
GAGGCGAAGTTGTGCGAGCTGTTCGCGGAGGTGCTCGGCCTGGAGGAGGTGGGCGCCGGC
GACAGCTTCTTCGAGCTCGGCGGCGACTCGATCACCTCGATGCAGCTGTCGGCCCTGGCC
CGCCGGAAGGGGCTGGACCTCACCCCGTGGCAGGTGTTCGACGAGAAGACGGCGGAACGG
CTGGCGGCGGTCGTCAAGGAGCTCCCGGCCGACGGCGAGGGCACCGGGGAACCGGAGCCC
CCGGCCGGCACACTCGTGGATCTTTCGCCTGATCAGCTGGACCAACTCGAGGCCGGACCG
GCCGGCGGATGA
[4] C7..301
[4] A482..879
[4] L-4-hydroxyphenylglycine(Hpg)649..749
[4] PCP957..1023
[4] E1060..1493
[5] C1502..1792
[5] A1972..2371
[5] L-4-hydroxyphenylglycine(Hpg)2136..2236
[5] PCP2454..2520
[5] E2566..3006
[6] C3018..3309
[6] A3492..3886
[6] tyrosine3658..3753
[6] PCP3980..4046
[4] C19..903
[4] A1444..2637
[4] L-4-hydroxyphenylglycine(Hpg)1945..2247
[4] PCP2869..3069
[4] E3178..4479
[5] C4504..5376
[5] A5914..7113
[5] L-4-hydroxyphenylglycine(Hpg)6406..6708
[5] PCP7360..7560
[5] E7696..9018
[6] C9052..9927
[6] A10474..11658
[6] tyrosine10972..11259
[6] PCP11938..12138

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [482-879]  1.69999999999998e-113 PF00501 [1972-2371]  9.3000000000001e-105 PF00501 [3492-3886]  9.60000000000004e-108 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [7-301]  5.20000000000001e-69 PF00668 [1060-1328]  4.80000000000001e-32 PF00668 [1502-1792]  1.6e-63 PF00668 [2566-2835]  2.5e-32 PF00668 [3018-3309]  1.40000000000001e-59 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [982-997]  PS00012 [2479-2494]  PS00012 [4005-4020]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [957-1023]  PS50075 [2454-2520]  PS50075 [3980-4046]  PS50075
PS50075   ACP_DOMAIN
 [961-1021]  3.2e-12 PF00550 [2457-2516]  1.3e-08 PF00550 [3983-4044]  2.7e-10 PF00550
PF00550   PP-binding
 [950-1024]  1.20000117458134e-17 SSF47336 [2447-2521]  1e-15 SSF47336 [3973-4047]  6.39998633403535e-18 SSF47336
SSF47336   ACP_like
 [950-1025]  2.39999999999997e-72 G3DSA:1.10.1200.10 [2445-2520]  2.39999999999997e-72 G3DSA:1.10.1200.10 [3970-4048]  2.39999999999997e-72 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010060 Non-ribosomal peptide synthase (Domain)
 [1338-1493]  4.00000000000001e-31 TIGR01720 [2850-3006]  4.2e-40 TIGR01720
TIGR01720   NRPS-para261
IPR010071 Amino acid adenylation domain (Domain)
 [482-879]  TIGR01733 [1972-2371]  9.69999999999989e-125 TIGR01733 [3492-3886]  2.20000000000002e-124 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [958-1026]  9.5000102816722e-10 SM00823 [2455-2523]  1.79999951654677e-05 SM00823 [3981-4049]  4.39999967439747e-06 SM00823
SM00823   PKS_PP
IPR020845 AMP-binding, conserved site (Conserved_site)
 [603-614]  PS00455 [2090-2101]  PS00455 [3610-3621]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit