close all open/close all

CDS information : A4092_00240


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction45,223 / 42,962 / - [in whole cluster]
45,223 / 42,962 / - [in contig]
Locationcomplement(42962..45223) [in whole cluster]
complement(42962..45223) [in contig]
TypeCDS
Length2,262 bp (753 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter permease protein
Product (GenBank)putative ABC transporter, Dbv18
Gene
Gene (GenBank)dbv18
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
Family/Domain
FD
IPR003838

close this sectionSequence

selected fasta
>putative ABC transporter permease protein [putative ABC transporter, Dbv18]
MAGFGAPFRNSDHVVSKLTNEDAFELVERHGANASPLGRAMLTVRAGDRSYPEMGVGPVA
ESKDLRWQQLTSGRFPERKGEAVVDLWDAQNWDVAVGDRIRIGERATAADFTVVGIVRAP
SPVAQASVYVTWPQLMRWADDPSLGIYTVTVRGAVGPVPETAKVQTPEQEIAARTAQLQN
GVDTWSLLLLLFAGIAVFVSILVIANTFSILLAQRMRDFALLRCVGATRRQVVSSVRREA
AVVGLLSSLAGVLVGAGLGYGLIALIKTLSPITPIAAPAPPAPWLLGGLAIGLTATLVAA
WLPIRRVVRVSPLAALRPDTATDPRTATGRARLVLGVFMLIAGLVLLASAMAWHSTVLML
AGGGSLFTGVLLFGPVLIPRLLEITGTRLGTIGRLATKNAVRNPRRTATTAASLLVGITL
ITAVLTGVAITSEALNERLDGQHPIDAALVSTGKPFSADFLDKVRGTSGVDQAIAVDGAV
ATVSGLDKPIPVVTAPDAQRVAHDGGSFARVEPGVLRLDESAFRQLRLRAGDKVRVTVGD
RRAVLQVSLATGWGLQAVVAPETLARLTDSAAPRAVWIRASADADSTRLVGELGDLAAAA
GANVNDQLEARETENAPLMILTWAIVALLGFSVAIALVGIANTLGLSVLERVREHALLRA
LGLTRRQLRRMLAAEAVLLSLVAAVLGTVIGIGFAWVGYETFVKQALDNATMQVPWPLLA
VVVLVAALAGLLASVLPARRAVRVTPAAGLSFE
selected fasta
>putative ABC transporter permease protein [putative ABC transporter, Dbv18]
ATGGCCGGCTTCGGGGCGCCGTTCCGCAACTCCGACCACGTGGTGTCCAAGCTGACGAAC
GAGGATGCGTTCGAGCTCGTCGAGCGTCATGGCGCGAACGCGTCACCGCTCGGCAGGGCC
ATGCTGACGGTGCGCGCGGGTGACCGGTCCTACCCCGAGATGGGCGTGGGGCCGGTCGCC
GAGTCCAAGGACCTGCGCTGGCAGCAGCTCACCTCGGGCCGTTTCCCCGAGCGCAAGGGC
GAGGCCGTGGTGGACCTGTGGGACGCCCAGAACTGGGACGTCGCCGTCGGCGACCGCATC
CGGATAGGTGAGCGTGCCACGGCAGCCGACTTCACCGTGGTCGGCATCGTGCGGGCGCCT
TCTCCTGTGGCGCAGGCGTCGGTGTACGTCACCTGGCCGCAGCTCATGCGCTGGGCCGAC
GATCCCTCCCTCGGCATCTACACGGTGACGGTGCGCGGCGCGGTCGGTCCGGTGCCCGAG
ACCGCGAAGGTGCAGACCCCGGAGCAGGAGATCGCGGCCCGGACGGCGCAGCTCCAGAAC
GGCGTGGACACCTGGTCACTGCTGCTGCTGCTCTTCGCCGGCATCGCCGTGTTCGTCTCG
ATCCTGGTCATCGCGAACACCTTCTCCATCCTGCTGGCCCAGCGCATGCGCGACTTCGCC
CTGTTGCGCTGCGTCGGTGCGACCCGCCGCCAGGTGGTGAGTTCGGTACGCCGGGAGGCG
GCCGTCGTCGGCCTCCTGTCGTCGCTGGCCGGCGTGCTGGTCGGCGCCGGACTCGGCTAC
GGGCTCATCGCCCTGATCAAGACCCTCTCACCGATCACCCCGATCGCCGCCCCGGCACCG
CCCGCGCCGTGGCTGCTGGGCGGGCTCGCCATCGGGCTGACGGCCACCCTGGTCGCGGCC
TGGCTGCCGATCCGGCGCGTGGTGCGGGTGAGCCCGCTGGCGGCACTGCGTCCCGACACC
GCGACCGACCCGCGTACAGCCACGGGGCGGGCACGGCTGGTGCTCGGCGTCTTCATGTTG
ATCGCCGGGCTCGTCCTGCTCGCGTCGGCGATGGCTTGGCACAGCACGGTGCTCATGCTG
GCCGGCGGCGGTTCGTTGTTCACCGGCGTGCTCCTGTTCGGGCCGGTGCTCATCCCCCGT
CTGCTGGAGATCACCGGTACGCGGCTCGGCACCATCGGGCGGCTCGCGACGAAGAACGCC
GTGCGCAACCCGCGCCGGACCGCCACCACCGCCGCCTCACTGCTGGTCGGTATCACCCTG
ATCACCGCCGTCCTGACCGGCGTCGCCATCACCTCCGAGGCGCTGAACGAGAGACTCGAC
GGCCAGCACCCCATCGACGCCGCGCTGGTCTCGACCGGCAAGCCGTTCTCCGCCGACTTC
CTCGACAAGGTCCGTGGCACTTCCGGGGTGGATCAGGCCATCGCGGTGGACGGCGCCGTC
GCCACGGTCTCCGGCCTCGACAAGCCGATCCCGGTGGTCACCGCGCCGGATGCCCAGCGG
GTGGCCCACGACGGCGGGTCGTTCGCCCGGGTGGAGCCAGGCGTGCTCAGGCTCGATGAG
TCCGCATTCCGCCAGCTGCGCCTGCGGGCCGGTGACAAGGTCAGGGTCACGGTCGGCGAC
CGGCGGGCCGTGCTGCAGGTCTCGCTCGCCACCGGCTGGGGGCTGCAGGCCGTCGTCGCG
CCGGAGACGCTGGCCCGGCTCACCGACTCCGCCGCGCCGCGTGCCGTCTGGATCCGCGCA
TCCGCCGACGCCGACTCGACGCGGCTCGTCGGTGAGCTGGGCGACCTGGCGGCCGCGGCC
GGGGCGAACGTGAACGACCAGCTGGAGGCCCGTGAGACGGAGAACGCGCCGCTGATGATC
CTCACCTGGGCCATCGTCGCGCTGCTCGGCTTCTCCGTGGCGATCGCCCTCGTCGGGATC
GCCAACACCCTGGGCCTGTCCGTTCTCGAGCGTGTTCGCGAACACGCGCTGCTGCGCGCG
CTCGGGCTCACTCGCAGGCAGTTGCGGCGGATGCTGGCCGCCGAGGCCGTGCTGCTCTCC
CTGGTGGCCGCCGTGCTCGGCACCGTGATCGGCATCGGGTTCGCCTGGGTCGGTTACGAG
ACCTTCGTGAAGCAGGCTCTCGACAACGCCACCATGCAGGTCCCCTGGCCACTGCTCGCC
GTCGTCGTCCTCGTCGCCGCCCTGGCGGGGCTCCTGGCCAGTGTTCTCCCGGCACGCCGG
GCCGTCCGGGTGACGCCGGCCGCGGGGCTTTCCTTCGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003838 Permease FtsX-like (Domain)
 [191-312]  1.3e-19 PF02687 [628-746]  2.7e-23 PF02687
PF02687   FtsX
IPR025857 MacB-like periplasmic core domain (Domain)
 [12-163]  2.5e-08 PF12704 [396-537]  2.2e-07 PF12704
PF12704   MacB_PCD
SignalP No significant hit
TMHMM
 [191-213]  Transmembrane (o-i) [240-262]  Transmembrane (i-o) [282-304]  Transmembrane (o-i) [331-353]  Transmembrane (i-o) [357-379]  Transmembrane (o-i) [408-430]  Transmembrane (i-o) [619-641]  Transmembrane (o-i) [677-699]  Transmembrane (i-o) [714-736]  Transmembrane (o-i)
Transmembrane 9