close all open/close all

CDS information : A4092_00250


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction46,053 / 45,355 / - [in whole cluster]
46,053 / 45,355 / - [in contig]
Locationcomplement(45355..46053) [in whole cluster]
complement(45355..46053) [in contig]
TypeCDS
Length699 bp (232 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative ABC transporter ATP-binding protein
Product (GenBank)putative ABC transporter, Dbv19
Gene
Gene (GenBank)dbv19
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
Related Reference
ACC
Q58206
PmId
[11402022] The crystal structure of the MJ0796 ATP-binding cassette. Implications for the structural consequences of ATP hydrolysis in the active site of an ABC transporter. (J Biol Chem. , 2001)
[12150914] ATP binding to the motor domain from an ABC transporter drives formation of a nucleotide sandwich dimer. (Mol Cell. , 2002)

close this sectionSequence

selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter, Dbv19]
MTGQRAALETVAASARNLTKVYGQGETRVHALRGVDLDLPRGKFTAIMGSSGSGKSTLMH
CLAGLDQASDGTVTVAGTDLGSLDDNELTVFRREHIGFVFQSFNLLPMLTAFQNITLPLE
LGGRRIDDAATERVHVLAETLGMADRLGHRPSEMSGGQQQRVAIARALITGPDLLFADEP
TGNLDSTTSAEVLGYLHKSTRELGQTVVMVTHEREAAAYADGVVTLEDGRIA
selected fasta
>putative ABC transporter ATP-binding protein [putative ABC transporter, Dbv19]
ATGACCGGCCAGCGAGCCGCTCTGGAAACCGTGGCGGCCAGCGCGCGAAACCTGACCAAG
GTGTACGGCCAGGGTGAAACCCGCGTGCATGCCCTGCGCGGCGTCGACCTCGACCTCCCG
CGCGGCAAGTTCACCGCGATCATGGGGTCGAGCGGATCGGGCAAGTCCACGTTGATGCAC
TGCCTGGCCGGGCTCGATCAGGCGAGCGATGGCACTGTCACCGTGGCCGGCACCGATCTC
GGATCACTCGACGACAACGAGCTCACGGTCTTCCGCCGTGAGCACATCGGCTTCGTGTTC
CAGTCTTTCAACCTGCTGCCGATGCTCACGGCGTTCCAGAACATCACGCTCCCGCTCGAG
CTCGGCGGCCGGCGCATCGACGACGCGGCGACCGAGCGCGTGCACGTGCTCGCCGAAACC
CTCGGCATGGCCGACCGGCTCGGCCACCGGCCCTCCGAGATGTCCGGCGGCCAGCAGCAG
CGGGTGGCCATCGCCCGGGCTCTGATCACCGGGCCGGATCTGCTGTTCGCCGACGAGCCC
ACCGGAAACCTCGACAGCACCACCTCGGCGGAGGTCCTGGGGTACCTGCACAAATCCACC
CGCGAGCTGGGCCAGACCGTCGTGATGGTCACCCACGAGCGTGAGGCCGCGGCCTACGCC
GACGGCGTGGTCACCCTGGAAGACGGACGGATCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003439 ABC transporter-like (Domain)
 [13-232]  PS50893
PS50893   ABC_TRANSPORTER_2
 [56-181]  5.80000000000004e-24 PF00005
PF00005   ABC_tran
IPR003593 AAA+ ATPase domain (Domain)
 [41-230]  1e-18 SM00382
SM00382   AAA
IPR017871 ABC transporter, conserved site (Conserved_site)
 [154-168]  PS00211
PS00211   ABC_TRANSPORTER_1
SignalP No significant hit
TMHMM No significant hit