close all open/close all

CDS information : A4092_00260


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction47,934 / 46,327 / - [in whole cluster]
47,934 / 46,327 / - [in contig]
Locationcomplement(46327..47934) [in whole cluster]
complement(46327..47934) [in contig]
TypeCDS
Length1,608 bp (535 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative mannosyltransferase
Product (GenBank)putative mannosyltransferase
Gene
Gene (GenBank)dbv20
EC number2.4.1.-
Keyword
  • Dpg7
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)
Related Reference
PmId
[23892980] Functional identification of the gene encoding the enzyme involved in mannosylation in ramoplanin biosynthesis in Actinoplanes sp. (Biotechnol Lett. , 2013)
[25878261] Engineered biosynthesis of enduracidin lipoglycopeptide antibiotics using the ramoplanin mannosyltransferase Ram29. (Microbiology. , 2015)

close this sectionSequence

selected fasta
>putative mannosyltransferase [putative mannosyltransferase]
MSHITMTPPSACRDPAPAGRFPRWAVWRSPPGQPWWARPALLCIAATAAVLYAWNLPLVD
YAPRYSDAVKSMSENWKAFLYGTVDVQATYTLDKLAGAFVPQAISVKIFGFHAWALALPQ
VIEGVISVLVMYRIVRRWAGVVPGLLAAAVFTITPVAASMFGHSMADGALVMCLVLAVDS
YQRAVLEGRLRSLVWAGVWVGLGFQAKMLQAWMILPALAIGYLLSAPIGLRRRLQHLGIA
GVVTLVVSLSWITLYHVTPAADRPYISGTTNSSAAAMVFGYNGLGRLGINLPGALPPNYM
GSVIGPAPPKRSTQLPRPRPGMVIPEIGIEHGGGWGKLFGGRLGVASGWLYPLALMALLC
GLWWWRRAERTDPARGGMVMWGVWLLTFALPYSAVFVIPHSAYVAVLAPPVAALSGIGIV
MFWRAYRSGGRMAWIFPLAIVAELAWAVWLWSFYPTFLPWAMWGAVALGVVAVVALALAR
LVRPRRSSLVSAGLTIGVAAMLAAPATWSASVLDPRYGGSSFDANAGPAARTPGG
selected fasta
>putative mannosyltransferase [putative mannosyltransferase]
ATGTCGCACATCACCATGACTCCGCCGTCCGCGTGCCGGGACCCCGCACCCGCCGGCAGA
TTCCCCCGCTGGGCGGTGTGGCGCTCGCCGCCCGGCCAGCCGTGGTGGGCCCGGCCGGCG
CTGCTCTGCATCGCGGCCACGGCAGCGGTGCTCTACGCCTGGAACCTGCCGCTGGTCGAC
TACGCACCGAGATACTCGGACGCCGTCAAGAGCATGTCCGAGAACTGGAAGGCGTTCCTG
TACGGCACCGTCGACGTGCAGGCGACCTACACGCTCGACAAGCTCGCCGGGGCCTTCGTG
CCGCAGGCCATCTCGGTCAAGATCTTCGGCTTCCACGCCTGGGCCCTTGCCTTGCCGCAG
GTGATCGAGGGCGTGATCTCGGTGCTGGTGATGTACCGGATCGTGCGGCGATGGGCGGGC
GTGGTGCCAGGTCTGCTCGCCGCCGCCGTCTTCACCATCACCCCCGTGGCCGCGTCCATG
TTCGGGCACAGCATGGCCGATGGGGCGCTGGTCATGTGCCTGGTGCTCGCCGTCGACTCC
TATCAGCGGGCCGTGCTGGAAGGACGGCTGCGGTCGCTGGTCTGGGCCGGCGTCTGGGTC
GGGCTGGGTTTCCAGGCGAAGATGTTGCAGGCGTGGATGATCCTGCCCGCCCTGGCGATC
GGTTATCTCCTGAGCGCGCCGATCGGACTGCGCCGTCGGCTGCAGCACCTGGGGATCGCC
GGAGTGGTGACGCTCGTGGTGTCGCTGTCGTGGATCACGCTCTACCACGTCACTCCGGCC
GCCGACCGGCCCTACATCAGCGGCACCACGAACAGCAGCGCCGCCGCGATGGTGTTCGGG
TACAACGGTCTCGGACGCCTGGGCATCAATCTGCCCGGCGCCCTGCCGCCCAACTACATG
GGCTCGGTGATCGGCCCGGCGCCTCCGAAGAGATCGACGCAGCTGCCCCGGCCACGCCCT
GGCATGGTCATCCCCGAGATAGGCATCGAGCATGGGGGCGGCTGGGGCAAGCTGTTCGGC
GGCCGCCTCGGCGTCGCGTCCGGTTGGCTGTATCCGCTCGCGCTGATGGCTCTGCTGTGC
GGGCTGTGGTGGTGGCGCCGGGCCGAGCGTACCGACCCGGCACGCGGCGGAATGGTGATG
TGGGGCGTGTGGCTTCTCACCTTCGCCCTGCCCTACAGCGCGGTCTTTGTCATCCCGCAC
AGCGCATATGTGGCCGTACTCGCGCCGCCGGTAGCCGCTTTGTCCGGAATCGGCATTGTA
ATGTTCTGGCGGGCGTATCGGAGCGGAGGCAGGATGGCGTGGATATTTCCGCTCGCGATC
GTGGCCGAACTCGCCTGGGCCGTCTGGTTGTGGTCCTTCTACCCCACTTTTCTGCCGTGG
GCGATGTGGGGCGCGGTCGCGCTCGGCGTGGTCGCCGTCGTCGCGCTCGCGCTGGCGCGG
CTGGTCAGGCCCCGTCGTAGTTCGCTGGTCAGCGCCGGGCTCACCATCGGCGTCGCGGCC
ATGCTGGCCGCGCCCGCCACGTGGTCCGCATCCGTGCTCGACCCCAGGTACGGCGGCAGT
TCCTTCGACGCCAACGCCGGACCAGCGGCCCGGACACCCGGGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM
 [36-58]  Transmembrane (o-i) [78-100]  Transmembrane (i-o) [110-132]  Transmembrane (o-i) [139-161]  Transmembrane (i-o) [208-230]  Transmembrane (o-i) [237-259]  Transmembrane (i-o) [343-365]  Transmembrane (o-i) [377-399]  Transmembrane (i-o) [404-426]  Transmembrane (o-i) [433-455]  Transmembrane (i-o) [460-482]  Transmembrane (o-i) [489-511]  Transmembrane (i-o)
Transmembrane 12