close all open/close all

CDS information : A4092_00270


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction48,786 / 47,974 / - [in whole cluster]
48,786 / 47,974 / - [in contig]
Locationcomplement(47974..48786) [in whole cluster]
complement(47974..48786) [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productdeacetylase
Product (GenBank)Dbv21 protein
Gene
Gene (GenBank)dbv21
EC number
Keyword
  • N-acyl-aminoglucuronic acid moiety
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17044690] Glycopeptide biosynthesis: Dbv21/Orf2 from dbv/tcp gene clusters are N-Ac-Glm teicoplanin pseudoaglycone deacetylases and Orf15 from cep gene cluster is a Glc-1-P thymidyltransferase. (J Am Chem Soc. , 2006)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[18559264] Crystal structures of lipoglycopeptide antibiotic deacetylases: implications for the biosynthesis of A40926 and teicoplanin. (Chem Biol. , 2008)
[25986904] Two Master Switch Regulators Trigger A40926 Biosynthesis in Nonomuraea sp. Strain ATCC 39727. (J Bacteriol. , 2015)

close this sectionSequence

selected fasta
>deacetylase [Dbv21 protein]
MLQDADRTRILAISPHLDDAVLSVGASLAQAEQDGGKVTVFTVFAGSAAPPYSPAAERFH
ARWGLSPTEDAPLRRRNEDIAALDQLGAGHRHGRFLDAIYRRSPDGQWLLHHNEGSMVRQ
QSPANNHDLVAAIREDIESMIAECDPTLVLTCVAIGKHPDHKATRDATLLAARERGIPLR
LWQDLPYAAYSQDLAELPDGLRLGSPELSFVDEEARTRKFQAMKHYATQLSVLDGPNKNL
FAKLDEHARNAAPDGGYNETTWPVIRYAAE
selected fasta
>deacetylase [Dbv21 protein]
ATGTTGCAGGACGCCGACCGAACCCGGATATTAGCAATCTCCCCTCATTTGGATGATGCC
GTCCTCTCCGTCGGAGCCAGCCTCGCCCAAGCGGAGCAGGACGGTGGAAAAGTAACCGTC
TTCACGGTGTTCGCCGGCAGCGCGGCGCCCCCTTATTCCCCGGCGGCGGAGCGATTCCAC
GCACGCTGGGGTCTGTCGCCGACCGAGGACGCGCCGCTGCGCCGACGAAATGAGGACATC
GCCGCCCTCGATCAGCTCGGTGCGGGCCATCGGCATGGCCGTTTTCTCGATGCCATCTAT
CGAAGGTCACCGGATGGCCAGTGGCTGCTGCACCACAACGAAGGCTCGATGGTCCGCCAG
CAGTCGCCGGCGAACAACCACGACCTGGTCGCCGCGATCAGGGAGGACATCGAGTCCATG
ATCGCGGAGTGCGATCCGACGCTCGTTCTCACCTGTGTGGCCATCGGGAAACACCCCGAC
CACAAGGCCACGCGGGATGCCACGCTGCTCGCCGCACGCGAGCGAGGTATTCCGCTGCGA
CTCTGGCAGGATCTCCCGTACGCGGCGTATTCCCAGGACCTGGCTGAATTGCCTGACGGC
CTCCGGCTCGGCTCTCCGGAGCTGAGTTTCGTCGATGAGGAGGCGCGGACGCGGAAATTC
CAGGCGATGAAGCACTACGCGACGCAGTTGTCGGTGCTCGACGGGCCGAACAAGAACCTG
TTCGCCAAACTCGATGAGCATGCCAGGAACGCCGCACCGGACGGCGGATATAACGAGACC
ACCTGGCCGGTCATTCGCTACGCAGCCGAGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003737 N-acetylglucosaminyl phosphatidylinositol deacetylase (Family)
 [11-171]  2.90000000000001e-20 PF02585
PF02585   PIG-L
IPR024078 Putative deacetylase LmbE-like domain (Domain)
 [6-247]  2.9000035467798e-41 SSF102588
SSF102588   SSF102588
 [7-241]  1.1e-28 G3DSA:3.40.50.10320
G3DSA:3.40.50.10320   G3DSA:3.40.50.10320
SignalP No significant hit
TMHMM No significant hit