close all open/close all

CDS information : A4092_00280


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction50,332 / 49,070 / - [in whole cluster]
50,332 / 49,070 / - [in contig]
Locationcomplement(49070..50332) [in whole cluster]
complement(49070..50332) [in contig]
TypeCDS
Length1,263 bp (420 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)putative sensory kinase
Gene
Gene (GenBank)dbv22
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
Related Reference
ACC
P0A4I8
PmId
[8885276] The cutRS signal transduction system of Streptomyces lividans represses the biosynthesis of the polyketide antibiotic actinorhodin. (Mol Microbiol. , 1996)

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [putative sensory kinase]
MAHRLRRLTTAFRSVRLRLTLVYGALFAASGVVLLAITYLLFRGSRPFVLVDGDPGGRFR
AFARQQQAAILENLLFQSLIALALMTVISFLLGWLVAGRMLRPLRTMNTTLKRISARNVH
ERLALPGPRDELRNLADTVDELLERLHSALDAQKRFVANAAHELRTPLTLEHALLEESLL
HRDADTPSMRSIMERLLDLSRQQGRLLESLLTLAKSEGGLDHREPLDLAEIAEHTIRTME
GTGPGADGNNPRAGVSADRRADGNSPTAGAATDSWADGKSLRAGCPHPRLVTGIAHAPTT
GDPALVERLITNLLDNAMRYNVPGGQVELSTRAEAGKAVVSIANTGPVVPPEQVHRLFEP
FQRLDRTRADDHHGLGLSIVRAIAVAHDATLTAHARPQGGLSVEIHFPLMRRALRRLAPS
selected fasta
>putative two-component system histidine kinase [putative sensory kinase]
GTGGCCCATCGTCTCCGACGCCTGACAACAGCCTTCCGCAGCGTACGGCTGCGCCTCACG
CTCGTCTACGGCGCGTTGTTCGCCGCCTCAGGGGTGGTCCTGCTCGCCATCACCTACCTG
CTCTTCCGCGGCTCCAGACCCTTCGTGCTGGTGGACGGTGACCCTGGCGGCAGGTTCCGC
GCCTTCGCGCGGCAGCAGCAGGCGGCCATTCTGGAGAACCTGCTGTTCCAATCGCTGATC
GCGCTGGCCCTGATGACGGTCATCTCGTTCTTGCTCGGCTGGCTGGTGGCAGGCAGGATG
CTGCGCCCGCTACGGACGATGAACACCACGCTCAAGCGGATCTCCGCCCGCAACGTCCAC
GAGCGGCTCGCCCTGCCCGGCCCGCGCGACGAGCTGCGCAACCTCGCCGACACGGTGGAC
GAGCTGCTGGAACGTCTCCACAGCGCCCTCGACGCGCAGAAGCGCTTCGTCGCCAACGCG
GCCCACGAGCTGCGCACCCCGCTCACCCTGGAGCACGCGTTGCTGGAGGAGAGCCTCCTG
CATCGGGACGCCGACACCCCGTCCATGCGATCGATCATGGAGCGGCTGCTCGACCTCAGC
CGGCAGCAGGGGCGCCTGCTGGAATCGCTGCTGACGCTGGCCAAGAGCGAGGGCGGCCTC
GATCACCGCGAGCCCCTGGATCTGGCGGAGATCGCCGAGCACACGATCCGCACGATGGAG
GGGACCGGCCCCGGGGCTGACGGGAACAACCCCAGGGCCGGCGTGAGTGCCGATCGGAGG
GCTGACGGGAACAGCCCCACGGCCGGCGCGGCAACCGATTCCTGGGCCGACGGGAAGTCC
CTCCGGGCCGGTTGCCCACACCCCCGATTGGTGACCGGGATCGCTCATGCCCCCACCACG
GGCGACCCGGCACTGGTCGAACGACTCATCACCAACCTTCTGGACAACGCCATGCGCTAC
AACGTGCCTGGCGGCCAGGTGGAGCTCTCCACCCGGGCCGAGGCCGGGAAGGCCGTCGTC
TCCATCGCCAACACCGGCCCGGTGGTGCCCCCCGAGCAGGTCCACCGCCTCTTCGAGCCC
TTCCAGCGGCTCGACCGCACCCGCGCCGACGACCACCACGGCCTCGGGCTGTCCATCGTC
CGCGCCATCGCCGTCGCCCACGACGCCACGTTGACCGCGCACGCGCGCCCGCAGGGTGGC
CTCTCGGTAGAGATCCACTTCCCCCTCATGCGGCGCGCGCTGCGCCGGCTGGCGCCATCC
TAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [302-409]  2.3e-21 PF02518
PF02518   HATPase_c
 [301-411]  8.5999877623955e-32 SM00387
SM00387   HATPase_c
 [261-409]  1.99999636034521e-29 SSF55874
SSF55874   ATP_bd_ATPase
 [296-411]  7.5e-29 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
IPR003660 HAMP linker domain (Domain)
 [79-147]  1.9e-14 PF00672
PF00672   HAMP
 [98-151]  PS50885
PS50885   HAMP
 [98-151]  1.49999977583352e-09 SM00304
SM00304   HAMP
IPR003661 Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain (Domain)
 [152-219]  1.09999909120787e-10 SM00388
SM00388   HisKA
 [153-219]  4.9e-08 PF00512
PF00512   HisKA
IPR005467 Signal transduction histidine kinase, core (Domain)
 [159-411]  PS50109
PS50109   HIS_KIN
IPR009082 Signal transduction histidine kinase, homodimeric (Domain)
 [134-219]  1.80000149287196e-13 SSF47384
SSF47384   His_kin_homodim
SignalP No significant hit
TMHMM
 [20-42]  Transmembrane (i-o) [75-97]  Transmembrane (o-i)
Transmembrane 2