close all open/close all

CDS information : A4092_00290


close this sectionLocation

Organism
StrainATCC 39727
Entry nameA40926
Contig
Start / Stop / Direction52,557 / 50,428 / - [in whole cluster]
52,557 / 50,428 / - [in contig]
Locationcomplement(50428..52557) [in whole cluster]
complement(50428..52557) [in contig]
TypeCDS
Length2,130 bp (709 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductD-mannose C-6' O-acetyltransferase
Product (GenBank)putative acyltransferase
Gene
Gene (GenBank)dbv23
EC number2.3.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12837387] The gene cluster for the biosynthesis of the glycopeptide antibiotic A40926 by nonomuraea species. (Chem Biol. , 2003)
[17873036] Phosphate-controlled regulator for the biosynthesis of the dalbavancin precursor A40926. (J Bacteriol. , 2007)
[20414653] Improved production of A40926 by Nonomuraea sp. through deletion of a pathway-specific acetyltransferase. (Appl Microbiol Biotechnol. , 2010)

close this sectionSequence

selected fasta
>D-mannose C-6' O-acetyltransferase [putative acyltransferase]
MSLPTCACGLTPHAPSCAPRSEHAGGRSSESRTDIQGLRAIAVAAVVAFHLWPGGPTGGY
VGVDVFFVISGYLITSHLLRQPGHGGGRLLDFWARRVRRLIPAASLALLVTLAASVVWLP
LTVLGTAAREVIAATVYVENLRLALTQANYLDVDQPDWPAQHYWSLSIEEQFYLGWPLLL
GSAAWLAARVARGRRPPENFTRWSAVVVTGAVVAASLAWSVQKTATDPAAAYFVSTTRFW
ELALGGLLAAVLTVRAMPRARAVRAGLAWAGLGMIGWAVVRFDAETAFPGAAALVPTVGA
CLVIAAAADGLRGGPGRALAWRPVQWLGNASYAVYLWHWPPIMILPYALGRSLTVIESVG
VIALTLVLAALSQYLVEDRLRWHPVLVRSRRLTFAMLASCVVVVAGAGAGVVAYADAAER
TESAAFEAAASRAGSCLGAGVVRDPACQDLGLLMPPQVALKDKPAVYADGCVNKEPFIAR
NTCTYGPDAAGRRIALVGNSHAGHWVPALEKALWSERWQLTTYVQLACYTVDQPLVLEGA
GVSENCQKINKWAVGSIVNGGYDLVIMSNRTHVPLAGVSPAGQQAAAERAYRDTLRAFTG
AGLPVLVLRDTPAMPDSVPHCIAKHPDDLDSCGGPAGVVLRPDPLAAAARADDTGLVSVA
SVDHLVCGERCGPVIGGLIAYSDRSHLTTTFARTLAPEVTAAVRGALTR
selected fasta
>D-mannose C-6' O-acetyltransferase [putative acyltransferase]
ATGTCCCTTCCGACCTGCGCATGCGGGCTGACGCCGCACGCCCCGTCGTGTGCGCCGCGA
AGCGAGCACGCCGGCGGCCGGAGCTCCGAGTCCCGCACGGACATTCAGGGCCTCCGGGCG
ATCGCGGTGGCGGCGGTGGTCGCGTTCCACCTGTGGCCCGGCGGGCCGACCGGCGGGTAC
GTGGGGGTAGACGTCTTCTTCGTCATCTCCGGGTACCTCATCACGAGCCACCTGCTGCGT
CAGCCGGGACACGGCGGCGGGAGACTGCTGGACTTCTGGGCACGCCGCGTCCGCCGCCTC
ATCCCGGCCGCGAGCCTCGCGCTCCTGGTCACGCTCGCCGCGTCGGTGGTCTGGCTGCCG
CTCACGGTGCTGGGGACGGCGGCGCGTGAGGTGATCGCCGCCACGGTGTACGTGGAGAAC
CTGAGACTCGCGCTCACGCAGGCGAACTACCTCGACGTCGACCAGCCGGACTGGCCCGCG
CAGCACTACTGGTCGCTGTCCATCGAGGAACAGTTCTACCTCGGCTGGCCGCTGCTGCTG
GGGTCGGCGGCCTGGCTGGCCGCCCGGGTGGCACGGGGGCGTCGCCCTCCGGAGAACTTC
ACGAGGTGGAGCGCGGTGGTGGTCACGGGTGCGGTCGTGGCCGCGTCCCTCGCCTGGTCG
GTGCAGAAGACGGCGACCGATCCGGCCGCCGCGTACTTCGTGTCGACGACCCGCTTCTGG
GAGCTCGCGCTCGGCGGTCTGCTCGCCGCGGTTCTCACCGTACGCGCGATGCCGCGCGCG
CGGGCGGTCCGGGCCGGGCTCGCGTGGGCCGGCCTGGGCATGATCGGGTGGGCCGTGGTC
CGGTTCGACGCCGAGACGGCCTTCCCCGGAGCCGCCGCCCTGGTGCCGACAGTGGGGGCC
TGCCTGGTGATCGCAGCGGCCGCGGACGGTCTGCGCGGCGGACCCGGGCGGGCGCTGGCG
TGGCGGCCGGTCCAGTGGCTCGGCAACGCCTCCTACGCGGTGTACCTGTGGCATTGGCCG
CCGATCATGATCCTCCCGTACGCGCTGGGCCGCTCGCTGACCGTGATCGAGTCCGTGGGC
GTGATCGCGCTGACCCTGGTCCTCGCCGCGCTCTCGCAGTACCTCGTCGAGGACCGGCTG
CGCTGGCACCCGGTCCTGGTCCGCAGCCGCAGGCTCACGTTCGCGATGCTCGCGTCGTGC
GTGGTGGTCGTCGCAGGAGCGGGAGCGGGCGTCGTCGCCTACGCCGACGCCGCCGAGCGT
ACGGAGAGTGCCGCGTTCGAGGCCGCGGCCTCGCGGGCAGGGTCATGCCTGGGTGCCGGC
GTCGTGCGCGACCCGGCGTGCCAGGATCTGGGCCTGCTGATGCCTCCTCAGGTCGCGTTG
AAGGACAAGCCCGCCGTGTACGCGGACGGGTGCGTGAACAAGGAACCGTTCATCGCCCGG
AACACGTGCACGTACGGACCTGACGCCGCCGGCAGGCGCATCGCCCTGGTCGGGAACTCC
CACGCGGGACACTGGGTCCCGGCCCTGGAGAAGGCGCTGTGGAGCGAGCGCTGGCAGCTC
ACCACCTACGTACAGCTGGCGTGCTACACCGTCGATCAGCCGCTCGTCCTCGAAGGCGCG
GGGGTCTCGGAGAACTGCCAGAAGATCAACAAGTGGGCGGTCGGGTCCATCGTGAACGGC
GGCTACGACCTGGTGATCATGTCCAACCGTACGCATGTGCCGCTCGCCGGCGTCTCGCCA
GCCGGCCAGCAGGCCGCGGCCGAGCGGGCCTACCGCGACACGCTCCGGGCCTTCACCGGC
GCCGGCCTTCCGGTGCTCGTCCTGCGTGACACCCCGGCCATGCCGGACAGCGTGCCCCAC
TGCATCGCCAAGCACCCGGACGATCTGGACTCCTGCGGCGGCCCGGCCGGCGTCGTGCTC
CGGCCGGATCCGCTCGCCGCCGCCGCCCGCGCCGACGACACCGGCCTCGTCTCCGTGGCG
AGTGTCGATCACCTGGTGTGCGGCGAGCGGTGCGGCCCCGTCATCGGCGGCCTGATCGCC
TACTCCGACCGCAGCCACCTCACCACCACCTTCGCCCGCACCCTGGCGCCCGAGGTCACG
GCAGCGGTGCGCGGTGCGCTGACTCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002656 Acyltransferase 3 (Domain)
 [33-370]  1.5e-25 PF01757
PF01757   Acyl_transf_3
SignalP No significant hit
TMHMM
 [57-79]  Transmembrane (o-i) [100-122]  Transmembrane (i-o) [172-191]  Transmembrane (o-i) [203-220]  Transmembrane (i-o) [230-252]  Transmembrane (o-i) [265-282]  Transmembrane (i-o) [292-314]  Transmembrane (o-i) [327-349]  Transmembrane (i-o) [354-376]  Transmembrane (o-i) [392-414]  Transmembrane (i-o)
Transmembrane 10